Septin-6 Antibody

Analysis in human cell line SH-SY5Y.

Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.

Staining of human skin shows no positivity in squamous epithelial cells as expected.

Staining of human lymph node shows moderate cytoplasmic/membranous positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Septin-6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQ
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEPTIN6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Septin-6 Antibody

• KIAA0128SEP2septin 2
• MGC16619
• MGC20339
• SEPT2
• septin 6
• septin-6

Background

This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. One version of pediatric acute myeloid leukemia is the result of a reciprocal translocation between chromosomes 11 and X, with the breakpoint associated with the genes encoding the mixed-lineage leukemia and septin 2 proteins. This gene encodes four transcript variants encoding three distinct isoforms. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Septin-6 Antibody (NBP1-83824)(1)

Publication using NBP1-83824

• Froidevaux-Klipfel L, Poirier F, Boursier C et al. Modulation of septin and molecular motor recruitment in the microtubule environment of the Taxol-resistant human breast cancer cell line MDA-MB-231. Proteomics 2011-10-01 [PMID: 21761557]

Bioinformatics

• Gene Symbol: SEPTIN6
• Entrez:
  • 55752(Human)
  • 52398(Mouse)
  • 305227(Rat)
• Uniprot:
  • Q9NVA2(Human)