Septin-6 Antibody

Images

 
Western Blot: Septin-6 Antibody [NBP1-52840] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Septin-6 Antibody Summary

Immunogen
Synthetic peptides corresponding to SEPT6(septin 6) The peptide sequence was selected from the N terminal of 40427. Peptide sequence TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEPT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SEPT6(septin 6) and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Septin-6 Antibody

  • KIAA0128SEP2septin 2
  • MGC16619
  • MGC20339
  • SEPT2
  • septin 6
  • septin-6

Background

SEPT6 is a member of the septin family of GTPases. Members of this family are required for cytokinesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1023
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP1-83824
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001731-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-191
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15116
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89483
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19048
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-52840
Species: Hu
Applications: WB

Publications for Septin-6 Antibody (NBP1-52840) (0)

There are no publications for Septin-6 Antibody (NBP1-52840).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-6 Antibody (NBP1-52840) (0)

There are no reviews for Septin-6 Antibody (NBP1-52840). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Septin-6 Antibody (NBP1-52840) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Septin-6 Products

Bioinformatics Tool for Septin-6 Antibody (NBP1-52840)

Discover related pathways, diseases and genes to Septin-6 Antibody (NBP1-52840). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Septin-6 Antibody (NBP1-52840)

Discover more about diseases related to Septin-6 Antibody (NBP1-52840).
 

Pathways for Septin-6 Antibody (NBP1-52840)

View related products by pathway.

PTMs for Septin-6 Antibody (NBP1-52840)

Learn more about PTMs related to Septin-6 Antibody (NBP1-52840).
 

Research Areas for Septin-6 Antibody (NBP1-52840)

Find related products by research area.

Blogs on Septin-6

There are no specific blogs for Septin-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Septin-6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPT6