Septin-4 Antibody


Western Blot: Septin-4 Antibody [NBP1-90094] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunohistochemistry-Paraffin: Septin-4 Antibody [NBP1-90094] - Staining in human cerebral cortex and pancreas tissues using anti-SEPT4 antibody. Corresponding SEPT4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Septin-4 Antibody [NBP1-90094] - Staining of human cerebellum shows moderate cytoplasmic positivity in cells in granular layer and distinctly stained neuropil.
Immunohistochemistry-Paraffin: Septin-4 Antibody [NBP1-90094] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Septin-4 Antibody [NBP1-90094] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Septin-4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKS
Specificity of human Septin-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Brain Corpus Callosum Lysate (NB820-59410)
Control Peptide
Septin-4 Protein (NBP1-90094PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Septin-4 Antibody

  • Apoptosis-related protein in the TGF-beta signaling pathway
  • ARTSPeanut-like protein 2
  • Bradeion beta
  • Brain protein H5
  • CE5B3
  • Cell division control-related protein 2
  • Cerebral protein 7
  • H5
  • hucep-7
  • MART
  • peanut-like 2 (Drosophila)
  • peanut-like 2
  • PNUTL2CE5B3 beta
  • septin 4
  • septin-4
  • septin-M


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: ELISA, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Septin-4 Antibody (NBP1-90094) (0)

There are no publications for Septin-4 Antibody (NBP1-90094).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-4 Antibody (NBP1-90094) (0)

There are no reviews for Septin-4 Antibody (NBP1-90094). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Septin-4 Antibody (NBP1-90094) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Septin-4 Products

Bioinformatics Tool for Septin-4 Antibody (NBP1-90094)

Discover related pathways, diseases and genes to Septin-4 Antibody (NBP1-90094). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Septin-4 Antibody (NBP1-90094)

Discover more about diseases related to Septin-4 Antibody (NBP1-90094).

Pathways for Septin-4 Antibody (NBP1-90094)

View related products by pathway.

PTMs for Septin-4 Antibody (NBP1-90094)

Learn more about PTMs related to Septin-4 Antibody (NBP1-90094).

Research Areas for Septin-4 Antibody (NBP1-90094)

Find related products by research area.

Blogs on Septin-4

There are no specific blogs for Septin-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Septin-4 Antibody and receive a gift card or discount.


Gene Symbol SEPT4