Septin-4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Septin-4 Antibody [NBP1-90093] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Septin-4 Antibody [NBP1-90093] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells and cells in molecular layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Septin-4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEPT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Septin-4 Protein (NBP1-90093PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Septin-4 Antibody

  • Apoptosis-related protein in the TGF-beta signaling pathway
  • ARTSPeanut-like protein 2
  • Bradeion beta
  • BRADEION
  • Brain protein H5
  • CE5B3
  • Cell division control-related protein 2
  • Cerebral protein 7
  • H5
  • hCDCREL-2SEP4
  • hucep-7
  • MART
  • peanut-like 2 (Drosophila)
  • peanut-like 2
  • PNUTL2CE5B3 beta
  • septin 4
  • septin-4
  • septin-M

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-06757
Species: Hu
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
H00000389-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
MAB4645
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
AF4409
Species: Mu
Applications: WB

Publications for Septin-4 Antibody (NBP1-90093) (0)

There are no publications for Septin-4 Antibody (NBP1-90093).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-4 Antibody (NBP1-90093) (0)

There are no reviews for Septin-4 Antibody (NBP1-90093). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Septin-4 Antibody (NBP1-90093) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Septin-4 Products

Bioinformatics Tool for Septin-4 Antibody (NBP1-90093)

Discover related pathways, diseases and genes to Septin-4 Antibody (NBP1-90093). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Septin-4 Antibody (NBP1-90093)

Discover more about diseases related to Septin-4 Antibody (NBP1-90093).
 

Pathways for Septin-4 Antibody (NBP1-90093)

View related products by pathway.

PTMs for Septin-4 Antibody (NBP1-90093)

Learn more about PTMs related to Septin-4 Antibody (NBP1-90093).
 

Research Areas for Septin-4 Antibody (NBP1-90093)

Find related products by research area.

Blogs on Septin-4

There are no specific blogs for Septin-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Septin-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPT4