Septin-1 Antibody

Images

 
Western Blot: Septin-1 Antibody [H00001731-B02P] - Analysis of SEPT1 expression in MCF-7.
Western Blot: Septin-1 Antibody [H00001731-B02P] - Analysis of SEPT1 expression in transfected 293T cell line by SEPT1 polyclonal antibody. Lane 1: SEPT1 transfected lysate(40.37 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Septin-1 Antibody Summary

Immunogen
SEPT1 (NP_443070.1, 1 a.a. - 367 a.a.) full-length human protein. MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQQSQAQGEQSDAL
Specificity
SEPT1 - septin 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SEPT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Septin-1 Antibody

  • DIFF6SEP1
  • differentiation 6 (deoxyguanosine triphosphate triphosphohydrolase)
  • LARP
  • Peanut-like protein 3
  • PNUTL3MGC20394
  • septin 1
  • septin-1
  • Serologically defined breast cancer antigen NY-BR-24

Background

This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. This gene encodes a protein associated with the tau-based paired helical filament core, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89626
Species: Hu
Applications: WB, IHC, IHC-P
NB500-191
Species: Hu, Mu
Applications: WB, IP, PLA
NBP2-15116
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1023
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Septin-1 Antibody (H00001731-B02P) (0)

There are no publications for Septin-1 Antibody (H00001731-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-1 Antibody (H00001731-B02P) (0)

There are no reviews for Septin-1 Antibody (H00001731-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Septin-1 Antibody (H00001731-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Septin-1 Products

Bioinformatics Tool for Septin-1 Antibody (H00001731-B02P)

Discover related pathways, diseases and genes to Septin-1 Antibody (H00001731-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Septin-1 Antibody (H00001731-B02P)

Discover more about diseases related to Septin-1 Antibody (H00001731-B02P).
 

Pathways for Septin-1 Antibody (H00001731-B02P)

View related products by pathway.

PTMs for Septin-1 Antibody (H00001731-B02P)

Learn more about PTMs related to Septin-1 Antibody (H00001731-B02P).
 

Research Areas for Septin-1 Antibody (H00001731-B02P)

Find related products by research area.

Blogs on Septin-1

There are no specific blogs for Septin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Septin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPT1
Entrez
Uniprot