SEPHS2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SEPHS2 Antibody [NBP2-13293] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.

Immunohistochemistry-Paraffin: SEPHS2 Antibody [NBP2-13293] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SEPHS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SEPHS2 Antibody - BSA Free (NBP2-13293) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEPHS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SEPHS2 Protein (NBP2-13293PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SEPHS2 Antibody - BSA Free

• EC 2.7.9.3
• Selenophosphate synthase 2
• selenophosphate synthetase 2
• SPS2water dikinase 2

Background

SEPHS2 encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. This protein itself contains a selenocysteine residue in its predicted active site. The 3' UTR of the gene has a stem-loop secondary structure called a selenocysteine insertion sequence (SECIS) element, which allows UGA to direct the incorporation of selenocysteine rather than signal a translational stop. Alternatively spliced transcripts have been identified, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEPHS2