SEPHS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SEPHS2 Antibody [NBP2-13293] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: SEPHS2 Antibody [NBP2-13293] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEPHS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEPHS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SEPHS2 Protein (NBP2-13293PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEPHS2 Antibody

  • EC 2.7.9.3
  • Selenophosphate synthase 2
  • selenophosphate synthetase 2
  • SPS2water dikinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87008
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58195
Species: Hu
Applications: ICC/IF
NBP1-85511
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83992
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20571
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-14637
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-90979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-13293
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SEPHS2 Antibody (NBP2-13293) (0)

There are no publications for SEPHS2 Antibody (NBP2-13293).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEPHS2 Antibody (NBP2-13293) (0)

There are no reviews for SEPHS2 Antibody (NBP2-13293). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SEPHS2 Antibody (NBP2-13293) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEPHS2 Products

Bioinformatics Tool for SEPHS2 Antibody (NBP2-13293)

Discover related pathways, diseases and genes to SEPHS2 Antibody (NBP2-13293). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEPHS2 Antibody (NBP2-13293)

Discover more about diseases related to SEPHS2 Antibody (NBP2-13293).
 

Pathways for SEPHS2 Antibody (NBP2-13293)

View related products by pathway.

Research Areas for SEPHS2 Antibody (NBP2-13293)

Find related products by research area.

Blogs on SEPHS2

There are no specific blogs for SEPHS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEPHS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPHS2