SeP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SeP Antibody [NBP1-80766] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & the Golgi apparatus.
Immunohistochemistry-Paraffin: SeP Antibody [NBP1-80766] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SeP Antibody [NBP1-80766] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SeP Antibody [NBP1-80766] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SeP Antibody [NBP1-80766] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SeP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEPP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SeP Protein (NBP1-80766PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SeP Antibody

  • selenoprotein P, plasma, 1
  • SELP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67330
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-72961
Species: Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
H00009941-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-87431
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-92190
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for SeP Antibody (NBP1-80766) (0)

There are no publications for SeP Antibody (NBP1-80766).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SeP Antibody (NBP1-80766) (0)

There are no reviews for SeP Antibody (NBP1-80766). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SeP Antibody (NBP1-80766) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SeP Products

Bioinformatics Tool for SeP Antibody (NBP1-80766)

Discover related pathways, diseases and genes to SeP Antibody (NBP1-80766). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SeP Antibody (NBP1-80766)

Discover more about diseases related to SeP Antibody (NBP1-80766).
 

Pathways for SeP Antibody (NBP1-80766)

View related products by pathway.

PTMs for SeP Antibody (NBP1-80766)

Learn more about PTMs related to SeP Antibody (NBP1-80766).

Blogs on SeP

There are no specific blogs for SeP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SeP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPP1
Entrez
Uniprot