Recombinant Human SENP6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SENP6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human SENP6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDGTNLLSVDEDEDSETSKGKKLNRRSEIVANSSGEFILKTYVRRNKSESFKTLKGNPIGLNM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SENP6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SENP6 Protein

  • EC 3.4.22.-
  • KIAA0797FLJ11887
  • Sentrin/SUMO-specific protease SENP6
  • sentrin-specific protease 6
  • SSP1KIAA0389
  • SUMO1/sentrin specific peptidase 6,2810017C20Rik
  • SUMO1/sentrin specific protease 6
  • SUMO-1-specific protease 1
  • SUSP1FLJ11355

Background

SENP6 - SUMO1/sentrin specific protease 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-24651
Species: Hu, Mu, Eq, Pm
Applications: WB
NBP2-03852
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56405
Species: Hu, Mu
Applications: WB, Simple Western
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-56590
Species: Hu, Rt
Applications: WB, IHC, IF
NBP1-83060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
H00079092-T01
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
H00006047-A01
Species: Hu
Applications: WB, ELISA
NBP2-37956
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30865
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07087
Species: Hu

Publications for SENP6 Partial Recombinant Protein (H00026054-Q01) (0)

There are no publications for SENP6 Partial Recombinant Protein (H00026054-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SENP6 Partial Recombinant Protein (H00026054-Q01) (0)

There are no reviews for SENP6 Partial Recombinant Protein (H00026054-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SENP6 Partial Recombinant Protein (H00026054-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SENP6 Products

Bioinformatics Tool for SENP6 Partial Recombinant Protein (H00026054-Q01)

Discover related pathways, diseases and genes to SENP6 Partial Recombinant Protein (H00026054-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SENP6 Partial Recombinant Protein (H00026054-Q01)

Discover more about diseases related to SENP6 Partial Recombinant Protein (H00026054-Q01).
 

Pathways for SENP6 Partial Recombinant Protein (H00026054-Q01)

View related products by pathway.

PTMs for SENP6 Partial Recombinant Protein (H00026054-Q01)

Learn more about PTMs related to SENP6 Partial Recombinant Protein (H00026054-Q01).

Blogs on SENP6

There are no specific blogs for SENP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SENP6 Antibody (4B7)
H00026054-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SENP6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SENP6