Recombinant Human Seipin/BSCL2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Seipin/BSCL2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 259-357 of Human BSCL2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:WGGIWPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAAL

Protein/Peptide Type
Partial Recombinant Protein
Gene
BSCL2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris, pH 8.0

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Seipin/BSCL2 Protein

  • Berardinelli-Seip congenital lipodystrophy 2 (seipin)
  • Bernardinelli-Seip congenital lipodystrophy 2 (seipin)
  • Bernardinelli-Seip congenital lipodystrophy type 2 protein
  • BSCL2
  • FLJ16651
  • GNG3LG
  • HMN5
  • MGC4694
  • Seipin
  • spastic paraplegia 17 (Silver syndrome)
  • SPG17

Background

BSCL2 - Bernardinelli-Seip congenital lipodystrophy 2 (seipin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010555-D01P
Species: Hu
Applications: WB, ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2387
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-45808
Species: Hu
Applications: IHC
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1377
Species: Hu
Applications: WB, IP, ICC
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
H00002618-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-59263
Species: Hu
Applications: WB, IHC
H00026580-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01) (0)

There are no publications for Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01) (0)

There are no reviews for Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Seipin/BSCL2 Products

Bioinformatics Tool for Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01)

Discover related pathways, diseases and genes to Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01)

Discover more about diseases related to Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01).
 

Pathways for Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01)

View related products by pathway.

PTMs for Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01)

Learn more about PTMs related to Seipin/BSCL2 Partial Recombinant Protein (H00026580-Q01).

Blogs on Seipin/BSCL2

There are no specific blogs for Seipin/BSCL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Seipin/BSCL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BSCL2
Entrez