![Western Blot: Secretogranin V Antibody [NBP2-88235] - WB Suggested Anti-SCG5 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell](http://images.novusbio.com/fullsize/Secretogranin-V-Antibody-Western-Blot-NBP2-88235-img0001.jpg "Western Blot: Secretogranin V Antibody [NBP2-88235] - WB Suggested Anti-SCG5 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit Secretogranin V Antibody - BSA Free (NBP2-88235) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Secretogranin V. Peptide sequence: GPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SCG5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Secretogranin V Antibody (NBP2-88235)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SCG5 |
![Intracellular Staining by Flow Cytometry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Flow_Cytometry_3467.jpg)
![Immunocytochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunocytochemistry_12010.jpg)
![Immunohistochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunohistochemistry_12592.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")