Home » SEC63 » SEC63 Antibodies » SEC63 Antibody

SEC63 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SEC63 Antibody [NBP1-59954] - THP-1 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SEC63 Antibody [NBP1-59954] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SEC63 Antibody Summary

Immunogen
Synthetic peptides corresponding to SEC63(SEC63 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of SEC63. Peptide sequence WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC63
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SEC63 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SEC63 Antibody

  • PRO2507
  • SEC63 homolog (S. cerevisiae)
  • SEC63LERdj2
  • SEC63-like (S. cerevisiae)
  • translocation protein SEC63 homolog

Background

The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GRP78/HSPA5
Antibody
NBP1-06274
Western Blot: GRP78/HSPA5 Antibody [NBP1-06274] - Total protein from human HeLa and A431 cells, mouse 3T3 cells and rat PC12 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-GPR78 in blocking buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: GRP78/HSPA5 Antibody [NBP1-06274] - NIH-3T3 cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-GRP78/HSPA5 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on HeLa with GRP78/HSPA5 Antibody NBP1-06274 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (SA5-10033, Thermo Fisher).
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
BMP-3b/GDF-10
Antibody [Unconjugate
AF1543
BMP-3b/GDF-10 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB, IHC
SEC61A Antibody
NBP1-31267
Western Blot: SEC61A Antibody [NBP1-31267] - Whole cell extracts and extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with SEC61A1 antibody at a dilution of 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: SEC61A Antibody [NBP1-31267] - Analysis of methanol-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: SEC61A Antibody [NBP1-31267] - Paraffin-embedded Cal27 xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SEC62 Antibody
NBP1-84045
Western Blot: SEC62 Antibody [NBP1-84045] - Analysis in human cell line A-431.
Immunocytochemistry/Immunofluorescence: SEC62 Antibody [NBP1-84045] - Staining of human cell line A-431 shows positivity in endoplasmic reticulum.
Immunohistochemistry-Paraffin: SEC62 Antibody [NBP1-84045] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PRKCSH Antibody
NBP2-38492
Immunocytochemistry/Immunofluorescence: PRKCSH Antibody [NBP2-38492] - Immunofluorescent staining of human cell line MCF7 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: PRKCSH Antibody [NBP2-38492] - Staining in human thyroid gland and skeletal muscle tissues using anti-PRKCSH antibody. Corresponding PRKCSH RNA-seq data are presented for the same tissues.
Immunohistochemistry: PRKCSH Antibody [NBP2-38492] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HspA4 Antibody
NBP1-81696
Western Blot: HspA4 Antibody [NBP1-81696] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: HspA4 Antibody [NBP1-81696] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: HspA4 Antibody [NBP1-81696] - Staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DNAJA2 Antibody
(OTI3A10)
NBP2-02996
Western Blot: DNAJA2 Antibody (3A10) [NBP2-02996] Analysis of extracts (35ug) from 9 different cell lines by using anti-DNAJA2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: DNAJA2 Antibody (3A10) [NBP2-02996] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY DNAJA2.
Immunohistochemistry-Paraffin: DNAJA2 Antibody (3A10) [NBP2-02996] - Staining of paraffin-embedded Human thyroid tissue using anti-DNAJA2 mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DNAJB6 Antibody
(2C11-C1)
H00010049-M01
Western Blot: DNAJB6 Antibody (2C11-C1) [H00010049-M01] - DNAJB6 monoclonal antibody (M01), clone 2C11-C1 Analysis of DNAJB6 expression in Jurkat.
Immunocytochemistry/Immunofluorescence: DNAJB6 Antibody (2C11-C1) [H00010049-M01] - Analysis of monoclonal antibody to DNAJB6 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: DNAJB6 Antibody (2C11-C1) [H00010049-M01] - DNAJB6 monoclonal antibody (M01), clone 2C11-C1. Analysis of DNAJB6 expression in C32.
(6 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF
HSP40/DNAJB1
Antibody
NBP2-38988
Western Blot: HSP40/DNAJB1 Antibody [NBP2-38988] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/Immunofluorescence: HSP40/DNAJB1 Antibody [NBP2-38988] - Immunofluorescent staining of human cell line A549 shows localization to nucleus.
Immunohistochemistry-Paraffin: HSP40/DNAJB1 Antibody [NBP2-38988] - Staining in human adrenal gland and duodenum tissues using anti-DNAJB1 antibody. Corresponding DNAJB1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
UCN2 Antibody
NBP2-57622
Western Blot: UCN2 Antibody [NBP2-57622] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/Immunofluorescence: UCN2 Antibody [NBP2-57622] - Staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: UCN2 Antibody [NBP2-57622] - Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Polycystin 2
Antibody
NBP1-80944
Immunocytochemistry/Immunofluorescence: Polycystin 2 Antibody [NBP1-80944] - Staining of human cell line BJ shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: Polycystin 2 Antibody [NBP1-80944] - Staining of human kidney shows positivity in a subset of renal tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DNAJC1 Antibody
NBP1-85002
Western Blot: DNAJC1 Antibody [NBP1-85002] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-166
Immunohistochemistry-Paraffin: DNAJC1 Antibody [NBP1-85002] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.
Species: Hu
Applications: WB, IHC, IHC-P
Protein Disulfide
Isomerase/P4HB Antibo ...
H00005034-B01P
Western Blot: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of P4HB expression in human liver.
Immunocytochemistry/Immunofluorescence: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of purified antibody to P4HB on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Protein Disulfide Isomerase/P4HB Antibody [H00005034-B01P] - Analysis of P4HB expression in HeLa.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ICC/IF
Calnexin Antibody
NB100-1965
Western Blot: Calnexin Antibody [NB100-1965] - A dilution of 1/2000 used in TBS with 0.05% Tween-20. Bands visualized by ECL using goat anti-rabbit HRP at 1:2000.
Immunocytochemistry/Immunofluorescence: Calnexin Antibody [NB100-1965] - Antibody was tested at 1:50 in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: Calnexin Antibody [NB100-1965] - IHC analysis of CANX in mouse prostate using DAB with hematoxylin counterstain.
(9 Publications)
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
SIL1 Antibody
(OTI3E3)
NBP2-02377
Western Blot: SIL1 Antibody (3E3) [NBP2-02377] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SIL1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SIL1.
Immunocytochemistry/Immunofluorescence: SIL1 Antibody (3E3) [NBP2-02377] Staining of COS7 cells transiently transfected by pCMV6-ENTRY SIL1.
Immunohistochemistry-Paraffin: SIL1 Antibody (3E3) [NBP2-02377] - Staining of paraffin-embedded liver tissue using anti-SIL1 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Polycystin-1/PKD1
Antibody [Unconjugate ...
AF6270
Polycystin‑1/PKD1 was detected in immersion fixed HUVEC human umbilical vein endothelial cells using Sheep Anti-Human Polycystin‑1/PKD1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6270) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to cell membranes, cytoplasm and endoplasmic reticula. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC
UBE2J1 Antibody
(OTI3D1)
NBP2-45402
Western Blot: UBE2J1 Antibody (3D1) [NBP2-45402] - Analysis of extracts (35ug) from 9 different cell lines (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: UBE2J1 Antibody (3D1) [NBP2-45402] - Analysis of Carcinoma of Human prostate tissue.
Flow Cytometry: UBE2J1 Antibody (3D1) [NBP2-45402] - Analysis of Jurkat cells, using UBE2J1 antibody,(Red), compared to a nonspecific negative control antibody (Blue).
Species: Hu
Applications: WB, Flow, IHC
Cathepsin
A/Lysosomal Carboxype ...
1049-SE
Cathepsin A/Lysosomal Carboxypeptidase A
(2 Publications)
Species: Hu

Publications for SEC63 Antibody (NBP1-59954) (0)

There are no publications for SEC63 Antibody (NBP1-59954).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC63 Antibody (NBP1-59954) (0)

There are no reviews for SEC63 Antibody (NBP1-59954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC63 Antibody (NBP1-59954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEC63 Products

Bioinformatics Tool for SEC63 Antibody (NBP1-59954)

Discover related pathways, diseases and genes to SEC63 Antibody (NBP1-59954). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC63 Antibody (NBP1-59954)

Discover more about diseases related to SEC63 Antibody (NBP1-59954).
 

Pathways for SEC63 Antibody (NBP1-59954)

View related products by pathway.

PTMs for SEC63 Antibody (NBP1-59954)

Learn more about PTMs related to SEC63 Antibody (NBP1-59954).

Blogs on SEC63

There are no specific blogs for SEC63, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC63 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SEC63
Uniprot