SEC63 Antibody (NBP1-59954)

Western Blot: SEC63 Antibody [NBP1-59954] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SEC63 Antibody Summary

• Immunogen: Synthetic peptides corresponding to SEC63(SEC63 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of SEC63. Peptide sequence WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEC63
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against SEC63 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SEC63 Antibody

• PRO2507
• SEC63 homolog (S. cerevisiae)
• SEC63LERdj2
• SEC63-like (S. cerevisiae)
• translocation protein SEC63 homolog

Background

The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEC63
• Uniprot:
  • Q9UGP8(Human)