SEC63 Antibody - BSA Free

Western Blot: SEC63 Antibody [NBP1-59694] - HepG2 cell lysate, concentration 1.25ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

SEC63 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SEC63(SEC63 homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of SEC63. Peptide sequence WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEC63
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 88 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for SEC63 Antibody - BSA Free

• PRO2507
• SEC63 homolog (S. cerevisiae)
• SEC63LERdj2
• SEC63-like (S. cerevisiae)
• translocation protein SEC63 homolog

Background

The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. SEC63 is an integral membrane protein located in the rough ER.The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SEC63 Antibody (NBP1-59694)(1)

Publication using NBP1-59694

• Unger A, Roos A, Gangfu beta A et al. Microscopic and Biochemical Hallmarks of BICD2-Associated Muscle Pathology toward the Evaluation of Novel Variants International journal of molecular sciences 2023-04-06 [PMID: 37047781] (IHC-Fr, Human)
  
  Details:
  1:100 IHC-Fr dilution

Bioinformatics

• Gene Symbol: SEC63
• Uniprot:
  • Q9UGP8(Human)