SEC31B Antibody

Images

 
Immunohistochemistry-Paraffin: SEC31B Antibody [NBP1-85106] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC31B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HAQGSAVLGQQSPPFPFPRIVVGATLHSKETSSYRLGSQPSHQVPTPSPRPRVFTPQSSPAMPLAPSHPSPYQGPRTQNISDYRA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC31B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SEC31B Protein (NBP1-85106PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEC31B Antibody

  • DKFZP434M183
  • protein transport protein Sec31B
  • SEC31 homolog B (S. cerevisiae)
  • SEC31B-1DKFZp434M183
  • SEC31L2
  • SEC31-like 2 (S. cerevisiae)
  • SEC31-like 2
  • SEC31-like protein 2
  • SEC31-related protein B
  • secretory pathway component Sec31B-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89301
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB90551
Species: Hu, Mu, Rt
Applications: WB
NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
AF6015
Species: Hu, Mu, Rt
Applications: WB
664-LI/CF
Species: Hu
Applications: BA
NBP2-20261
Species: Hu
Applications: ICC/IF, WB
236-EG
Species: Hu
Applications: BA
NBP2-03381
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP1-88664
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for SEC31B Antibody (NBP1-85106) (0)

There are no publications for SEC31B Antibody (NBP1-85106).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC31B Antibody (NBP1-85106) (0)

There are no reviews for SEC31B Antibody (NBP1-85106). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SEC31B Antibody (NBP1-85106) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEC31B Products

Bioinformatics Tool for SEC31B Antibody (NBP1-85106)

Discover related pathways, diseases and genes to SEC31B Antibody (NBP1-85106). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC31B Antibody (NBP1-85106)

Discover more about diseases related to SEC31B Antibody (NBP1-85106).
 

Pathways for SEC31B Antibody (NBP1-85106)

View related products by pathway.

Blogs on SEC31B

There are no specific blogs for SEC31B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC31B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC31B