SEC24D Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SEC24D Antibody [NBP2-55382] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC24D Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQP
Specificity
Specificity of human SEC24D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC24D
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SEC24D Recombinant Protein Antigen (NBP2-55382PEP)

Reactivity Notes

Mouse 85%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SEC24D Antibody

  • FLJ43974
  • KIAA0755member D
  • SEC24 family, member D (S. cerevisiae)
  • SEC24 related gene family, member D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85867
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP2-34842
Species: Hu, Mu, Rt, Ha
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-85732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83139
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
NBP2-79775
Species: Hu
Applications: WB, IHC, IHC-P, PA
NBP2-20261
Species: Hu
Applications: WB, ICC/IF
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-88842
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004760-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-75545
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00513
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55382
Species: Hu
Applications: ICC/IF

Publications for SEC24D Antibody (NBP2-55382) (0)

There are no publications for SEC24D Antibody (NBP2-55382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC24D Antibody (NBP2-55382) (0)

There are no reviews for SEC24D Antibody (NBP2-55382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SEC24D Antibody (NBP2-55382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SEC24D Products

Bioinformatics Tool for SEC24D Antibody (NBP2-55382)

Discover related pathways, diseases and genes to SEC24D Antibody (NBP2-55382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC24D Antibody (NBP2-55382)

Discover more about diseases related to SEC24D Antibody (NBP2-55382).
 

Pathways for SEC24D Antibody (NBP2-55382)

View related products by pathway.

Blogs on SEC24D

There are no specific blogs for SEC24D, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC24D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC24D