SEC24D Antibody (6F8S4)

Western Blot: SEC24D Antibody (6F8S4) [NBP3-33280] - Western blot analysis of various lysates using SEC24D Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.

Western Blot: SEC24D Antibody (6F8S4) [NBP3-33280] - Western blot analysis of lysates from NIH/3T3 cells, using SEC24D Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 6F8S4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SEC24D Antibody (6F8S4) Summary

• Description: Novus Biologicals Rabbit SEC24D Antibody (6F8S4) (NBP3-33280) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SEC24D (NP_001304995.1).
  
  Sequence:
  MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGATATRGMLPPGPPPPGPHQFGQNGAHATGHPPQRFPGPPPVNNVASSHAPY
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SEC24D
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 113 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SEC24D Antibody (6F8S4)

• FLJ43974
• KIAA0755member D
• SEC24 family, member D (S. cerevisiae)
• SEC24 related gene family, member D

Background

SEC24D is encoded by this gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. This gene product is implicated in the shaping of the vesicle, and also in cargo selection and concentration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEC24D