SDK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SDK1 Antibody [NBP1-93882] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SDK1 Antibody [NBP1-93882] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SDK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ICNKYNGAVLTESVSLKEKSADASESEATDSDYEDALPKHSFVNHYMSDPTYYNSWKRRAQGRAPAPHRYEAVAGSEAGAQLHPVITTQSAGGVYTPAGPGARTPLTGFSS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SDK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SDK1 Protein (NBP1-93882PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SDK1 Antibody

  • protein sidekick-1
  • sidekick homolog 1, cell adhesion molecule (chicken)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
H00009223-M03
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-77180
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
AF2948
Species: Mu
Applications: ELISA, IHC, Simple Western, WB
DAD120
Species: Hu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NBP2-67912
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00009910-M05
Species: Hu
Applications: ELISA, IHC, IHC-P, WB

Publications for SDK1 Antibody (NBP1-93882) (0)

There are no publications for SDK1 Antibody (NBP1-93882).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SDK1 Antibody (NBP1-93882) (0)

There are no reviews for SDK1 Antibody (NBP1-93882). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SDK1 Antibody (NBP1-93882) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SDK1 Products

Array NBP1-93882

Bioinformatics Tool for SDK1 Antibody (NBP1-93882)

Discover related pathways, diseases and genes to SDK1 Antibody (NBP1-93882). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDK1 Antibody (NBP1-93882)

Discover more about diseases related to SDK1 Antibody (NBP1-93882).
 

Pathways for SDK1 Antibody (NBP1-93882)

View related products by pathway.

PTMs for SDK1 Antibody (NBP1-93882)

Learn more about PTMs related to SDK1 Antibody (NBP1-93882).

Blogs on SDK1

There are no specific blogs for SDK1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SDK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SDK1