SDHC Antibody (3G7)

Images

 
Western Blot: SDHC Antibody (3G7) [H00006391-M02] - detection against Immunogen (44.7 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SDHC Antibody (3G7) Summary

Immunogen
SDHC (AAH33626, 1 a.a. - 169 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM
Specificity
succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SDHC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publications using H00006391-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SDHC Antibody (3G7)

  • Integral membrane protein CII-3
  • mitochondrial
  • PGL3
  • QPs1
  • QPs-1
  • SDH3
  • succinate dehydrogenase complex, subunit C, integral membrane protein, 15kD
  • succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa
  • succinate-ubiquinone oxidoreducatase cytochrome B large subunit

Background

This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. Several related pseudogenes are located in different genomic regions. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-92372
Species: Hu
Applications: IHC, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NB100-485
Species: Hu
Applications: WB, IP
AF482
Species: Mu
Applications: WB, IHC
NBP1-92260
Species: Hu
Applications: WB, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91305
Species: Hu
Applications: WB
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
AF1062
Species: Mu
Applications: WB, IHC, Neut
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006391-M02
Species: Hu
Applications: WB, ELISA

Publications for SDHC Antibody (H00006391-M02)(2)

Reviews for SDHC Antibody (H00006391-M02) (0)

There are no reviews for SDHC Antibody (H00006391-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SDHC Antibody (H00006391-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SDHC Products

Bioinformatics Tool for SDHC Antibody (H00006391-M02)

Discover related pathways, diseases and genes to SDHC Antibody (H00006391-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDHC Antibody (H00006391-M02)

Discover more about diseases related to SDHC Antibody (H00006391-M02).
 

Pathways for SDHC Antibody (H00006391-M02)

View related products by pathway.

PTMs for SDHC Antibody (H00006391-M02)

Learn more about PTMs related to SDHC Antibody (H00006391-M02).
 

Research Areas for SDHC Antibody (H00006391-M02)

Find related products by research area.

Blogs on SDHC

There are no specific blogs for SDHC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SDHC Antibody (3G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SDHC
Entrez
OMIM
Uniprot