![Western Blot: SDF2 Antibody [NBP1-58376] - This Anti-SDF2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.](http://images.novusbio.com/fullsize/SDF2-Antibody-Western-Blot-NBP1-58376-img0001.jpg "Western Blot: SDF2 Antibody [NBP1-58376] - This Anti-SDF2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to SDF2(stromal cell-derived factor 2) The peptide sequence was selected from the N terminal of SDF2.
Peptide sequence KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SDF2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SDF2 Antibody (NBP1-58376)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: SDF2 Antibody [NBP1-58376] - Analysis of Human kidney.](http://images.novusbio.com/fullsize/SDF2-Antibody-Immunohistochemistry-NBP1-58376-img0002.jpg "Immunohistochemistry: SDF2 Antibody [NBP1-58376] - Analysis of Human kidney.")
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A CCL5/RANTES [HRP]](https://images.novusbio.com/images2/CCL5_DRN00_ELISA_393.jpg)
![N/A CCL5/RANTES [HRP]](https://images.novusbio.com/images2/DATA_CCL5_DRN00_ELISA_810.jpg)
![N/A CCL5/RANTES [HRP]](https://images.novusbio.com/images2/DATA_CCL5_DRN00_ELISA_811.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![N/A CXCL9/MIG [HRP]](https://images.novusbio.com/images2/CXCL9_DCX900_ELISA_75.jpg)
![N/A CXCL9/MIG [HRP]](https://images.novusbio.com/images2/DATA_CXCL9_DCX900_ELISA_646.jpg)
![N/A CXCL9/MIG [HRP]](https://images.novusbio.com/images2/DATA_CXCL9_DCX900_ELISA_647.jpg)
![Flow Cytometry CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Flow_Cytometry_22407.jpg)
![Neutralization CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Block_Neutralize_9044.jpg)
![Immunocytochemistry CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Immunocytochemistry_9681.jpg)
![Western Blot Integrin alpha L/CD11a Antibody (345913) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_L_MAB3595_Western_Blot_10266.jpg)
![Simple Western Integrin alpha L/CD11a Antibody (345913) [Unconjugated]](https://images.novusbio.com/images2/mab3595_human-integrin-alpha-l-cd11a-mab-clone-345913-simple-western-268202215744.jpg)
![N/A ST2/IL-33R [Biotin]](https://images.novusbio.com/images2/DATA_ST2_DY523_ELISA_2475.jpg)
![N/A ST2/IL-33R [Biotin]](https://images.novusbio.com/images2/DATA_ST2_DY523_ELISA_2088.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")