SDCCAG8 Antibody - BSA Free

Western Blot: SDCCAG8 Antibody [NBP2-13288] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: SDCCAG8 Antibody [NBP2-13288] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SDCCAG8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SDCCAG8 Antibody - BSA Free (NBP2-13288) is a polyclonal antibody validated for use in IHC and WB. Anti-SDCCAG8 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QLELEKLKLTYEEKCEIEESQLKFLRNDLAEYQRTCEDLKEQLKHKEFLLAANTCNRVGGLCLKCAQHEAVLSQTHTNVHMQTIERLVKERDDLMSAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SDCCAG8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SDCCAG8 Protein (NBP2-13288PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SDCCAG8 Antibody - BSA Free

• CCCAPAntigen NY-CO-8
• Centrosomal colon cancer autoantigen protein
• hCCCAP
• NPHP10
• NY-CO-8
• serologically defined colon cancer antigen 8
• SLSN7

Background

SDCCAG8 is a gene that codes for a protein with four isoforms, with weights of 713, 360, 634, and 669 amino acids and weights of approximately 83, 41, 73, and 78 kDa respectively. The protein coded by SDCCAG8 helps in the formation of epithelial lumen as well as the establishment of cell polarity and is expressed in the thymus, prostate, testis, ovary, small intestine and mucosa as well as in colon and renal cancer tumors. Current studies are being done on several diseases and disorders linked to this gene including colon cancer, Senior-Loken syndrome, Bardet-Biegl syndrome, retinitis, nystagmus, eye disease, polydactyly, multiple sclerosis, and prostatitis. SDCCAG8 has also been shown to have interactions with TSC1, TRAF6, ALMS1, CEP152, and CEP164 in pathways such as the centrosome maturation, cell cycle, and G2/M transition pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SDCCAG8 Antibody (NBP2-13288)(1)

Publication using NBP2-13288

• Rueben G. Das, Felipe Pompeo Marinho, Simone Iwabe, Evelyn Santana, Kendra Sierra McDaid, Gustavo D. Aguirre, Keiko Miyadera Variabilities in retinal function and structure in a canine model of cone-rod dystrophy associated with RPGRIP1 support multigenic etiology Scientific Reports 2017-10-09 [PMID: 28993665]

Bioinformatics

• Gene Symbol: SDCCAG8