Novus Biologicals products are now on bio-techne.com

SCYL2 Antibody - Azide and BSA Free

Images

 
Western Blot: SCYL2 Antibody [NBP2-93250] - Analysis of extracts of various cell lines, using SCYL2 . Exposure time: 90s.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SCYL2 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human SCYL2 (NP_060458.3). MESMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNKGKPIFEVNKQDIYKSFSRQLDQLSRLGSSSLTNIPEEV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCYL2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000-1:2000
Theoretical MW
103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for SCYL2 Antibody - Azide and BSA Free

  • CVAK104
  • FLJ10074
  • KIAA1360Coated vesicle-associated kinase of 104 kDa
  • SCY1-like 2 (S. cerevisiae)
  • SCY1-like protein 2

Background

SCYL2 is a component of AP2-containing clathrin coated structures at the plasma membrane or of endocytic coated vesicles. According to PubMed:15809293, probable serine/threonine-protein kinase that phosphorylates, in vitro, the beta2-subunit of the plasma membrane a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DDX0390P-100
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
H00002971-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-85570
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-24648
Species: Hu, Mu, Pm, Rt
Applications: WB
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
AF1120
Species: Mu
Applications: IHC, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
AF1617
Species: Hu
Applications: WB
AF5448
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-84110
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-33414
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93250
Species: Hu, Rt
Applications: WB

Publications for SCYL2 Antibody (NBP2-93250) (0)

There are no publications for SCYL2 Antibody (NBP2-93250).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCYL2 Antibody (NBP2-93250) (0)

There are no reviews for SCYL2 Antibody (NBP2-93250). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCYL2 Antibody (NBP2-93250) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCYL2 Products

Research Areas for SCYL2 Antibody (NBP2-93250)

Find related products by research area.

Blogs on SCYL2

There are no specific blogs for SCYL2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCYL2 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SCYL2