SCN7A Recombinant Protein Antigen

Images

 
There are currently no images for SCN7A Recombinant Protein Antigen (NBP3-17309PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SCN7A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCN7A

Source: E. coli

Amino Acid Sequence: LAMAYEEEKQRVGEISKKIEPKFQQTGKELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCN7A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17309.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SCN7A Recombinant Protein Antigen

  • Sodium channel protein cardiac and skeletal muscle subunit alpha
  • Sodium channel protein type VII subunit alpha
  • sodium channel, voltage-gated, type VI, alpha
  • sodium channel, voltage-gated, type VII, alpha polypeptide
  • sodium channel, voltage-gated, type VII, alpha
  • voltage-dependent sodium channel alpha subunit
  • voltage-gated, type VI, alpha polypeptide

Background

Voltage-dependent sodium channels mediate the sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, they form a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. These ion channel proteins exist as heteromultimeric complexes of a large alpha subunit and 1 or 2 smaller beta subunits. SCN7A (Sodium channel protein type 7 subunit alpha) is an alpha subunit and is expressed in heart and uterus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
AF2009
Species: Hu
Applications: ICC, IHC
AF5065
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB
NBP1-83790
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-96916
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
NBP1-80851
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DRB400
Species: Hu
Applications: ELISA
NBP1-88000
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
DY1857
Species: Mu
Applications: ELISA
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
DPI00
Species: Hu
Applications: ELISA
DCC270
Species: Hu
Applications: ELISA

Publications for SCN7A Recombinant Protein Antigen (NBP3-17309PEP) (0)

There are no publications for SCN7A Recombinant Protein Antigen (NBP3-17309PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCN7A Recombinant Protein Antigen (NBP3-17309PEP) (0)

There are no reviews for SCN7A Recombinant Protein Antigen (NBP3-17309PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SCN7A Recombinant Protein Antigen (NBP3-17309PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCN7A Products

Array NBP3-17309PEP

Research Areas for SCN7A Recombinant Protein Antigen (NBP3-17309PEP)

Find related products by research area.

Blogs on SCN7A

There are no specific blogs for SCN7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SCN7A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SCN7A