Recombinant Human SCLY Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SCLY Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 346-444 of Human SCLY partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NSQFPGTQRLPNTCNFSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGRSTTRAEVDLVVQDLKQAVAQLEDQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
SCLY

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCLY Protein

  • EC 4.4.1.16
  • SCLhSCL
  • selenocysteine lyase

Background

SCLY - selenocysteine lyase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NB110-83978
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, IHC, IHC-P
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-57016
Species: Hu
Applications: WB
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6116
Species: Hu
Applications: WB, ICC
H00051540-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SCLY Partial Recombinant Protein (H00051540-Q01) (0)

There are no publications for SCLY Partial Recombinant Protein (H00051540-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCLY Partial Recombinant Protein (H00051540-Q01) (0)

There are no reviews for SCLY Partial Recombinant Protein (H00051540-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCLY Partial Recombinant Protein (H00051540-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCLY Products

Bioinformatics Tool for SCLY Partial Recombinant Protein (H00051540-Q01)

Discover related pathways, diseases and genes to SCLY Partial Recombinant Protein (H00051540-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCLY Partial Recombinant Protein (H00051540-Q01)

Discover more about diseases related to SCLY Partial Recombinant Protein (H00051540-Q01).
 

Pathways for SCLY Partial Recombinant Protein (H00051540-Q01)

View related products by pathway.

PTMs for SCLY Partial Recombinant Protein (H00051540-Q01)

Learn more about PTMs related to SCLY Partial Recombinant Protein (H00051540-Q01).

Blogs on SCLY

There are no specific blogs for SCLY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SCLY Antibody
NBP2-48693

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCLY Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCLY