Recombinant Human SCC112 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SCC112 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-333 of Human PDS5A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDESGPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAERQIDLQR

Protein/Peptide Type
Recombinant Protein
Gene
PDS5A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCC112 Protein

  • Cell proliferation-inducing gene 54 protein
  • DKFZp686B19246
  • FLJ41012
  • KIAA0648MGC131948
  • PDS5
  • PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae)
  • PIG54
  • SCC-112MGC161503
  • Sister chromatid cohesion protein 112
  • sister chromatid cohesion protein PDS5 homolog A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-92579
Species: Hu
Applications: WB, IHC, IHC-P
NB100-204
Species: Hu, Mu, Xp
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-87957
Species: Hu
Applications: IHC, IHC-P
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NB100-755
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
29470002
Species: Ce
Applications: ELISA, ICC/IF, IHC
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-26626
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85110
Species: Hu
Applications: ICC/IF, IHC, IF
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-87021
Species: Hu
Applications: WB, IP, PLA
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
H00023244-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SCC112 Recombinant Protein (H00023244-P01) (0)

There are no publications for SCC112 Recombinant Protein (H00023244-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCC112 Recombinant Protein (H00023244-P01) (0)

There are no reviews for SCC112 Recombinant Protein (H00023244-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCC112 Recombinant Protein (H00023244-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCC112 Products

Bioinformatics Tool for SCC112 Recombinant Protein (H00023244-P01)

Discover related pathways, diseases and genes to SCC112 Recombinant Protein (H00023244-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCC112 Recombinant Protein (H00023244-P01)

Discover more about diseases related to SCC112 Recombinant Protein (H00023244-P01).
 

Pathways for SCC112 Recombinant Protein (H00023244-P01)

View related products by pathway.

PTMs for SCC112 Recombinant Protein (H00023244-P01)

Learn more about PTMs related to SCC112 Recombinant Protein (H00023244-P01).
 

Research Areas for SCC112 Recombinant Protein (H00023244-P01)

Find related products by research area.

Blogs on SCC112

There are no specific blogs for SCC112, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SMC1 Antibody
NB100-204
SCC112 Antibody
NBP1-87904

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCC112 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PDS5A