Recombinant Human SCARA3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SCARA3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 316-415 of Human SCARA3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCARA3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCARA3 Protein

  • APC7
  • CSR1
  • CSRCellular stress response gene protein
  • macrophage scavenger receptor-like 1
  • MSLR1cellular stress response protein
  • MSRL1
  • scavenger receptor class A member 3
  • scavenger receptor class A, member 3

Background

SCARA3 - scavenger receptor class A, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6387
Species: Hu
Applications: WB
NB100-56516
Species: Hu, Mu
Applications: WB, IHC
NBP1-97587
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00051435-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SCARA3 Partial Recombinant Protein (H00051435-Q01) (0)

There are no publications for SCARA3 Partial Recombinant Protein (H00051435-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCARA3 Partial Recombinant Protein (H00051435-Q01) (0)

There are no reviews for SCARA3 Partial Recombinant Protein (H00051435-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCARA3 Partial Recombinant Protein (H00051435-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCARA3 Products

Bioinformatics Tool for SCARA3 Partial Recombinant Protein (H00051435-Q01)

Discover related pathways, diseases and genes to SCARA3 Partial Recombinant Protein (H00051435-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCARA3 Partial Recombinant Protein (H00051435-Q01)

Discover more about diseases related to SCARA3 Partial Recombinant Protein (H00051435-Q01).
 

Pathways for SCARA3 Partial Recombinant Protein (H00051435-Q01)

View related products by pathway.

PTMs for SCARA3 Partial Recombinant Protein (H00051435-Q01)

Learn more about PTMs related to SCARA3 Partial Recombinant Protein (H00051435-Q01).

Blogs on SCARA3

There are no specific blogs for SCARA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
SCARA3 Antibody
NBP2-13286

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCARA3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCARA3