Home » SCAMP3 » SCAMP3 Proteins » Recombinant Human SCAMP3 Protein

Recombinant Human SCAMP3 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human SCAMP3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 70-169 of Human SCAMP3

Source: Wheat Germ

Amino Acid Sequence: QPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYY
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCAMP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCAMP3 Protein

  • propin 1
  • PROPIN1
  • SCAMP3
  • secretory carrier membrane protein 3C1orf3
  • secretory carrier-associated membrane protein 3

Background

SCAMP3 - secretory carrier membrane protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
SCAMP1 Protein
H00009522-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
LAMP-1/CD107a
Antibody
NB120-19294
Western Blot: LAMP-1/CD107a Antibody [NB120-19294] - Analysis of 20 ug of HeLa cell lysate and 5 ul of Molecular Weight Protein Ladder per well.
Immunocytochemistry/Immunofluorescence: LAMP-1/CD107a Antibody [NB120-19294] - Lamp1 (red) in HeLa cells.
(2 Reviews)
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
EGFR Antibody
[Unconjugated]
AF231
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
A431 human epithelial carcinoma cell line was stained with Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Review)
(7 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
TEL2 Antibody
NBP1-81761
Western Blot: TEL2 Antibody [NBP1-81761] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: TEL2 Antibody [NBP1-81761] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: TEL2 Antibody [NBP1-81761] - Staining of human urinary bladder shows cytoplasmic and nuclear positivity in urothelial cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Metaxin 1 Antibody
NBP1-87741
Western Blot: Metaxin 1 Antibody [NBP1-87741] - Analysis in human cell line MCF-7.
Immunocytochemistry/Immunofluorescence: Metaxin 1 Antibody [NBP1-87741] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Metaxin 1 Antibody [NBP1-87741] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CLK2 Antibody
NBP2-47506
Western Blot: CLK2 Antibody [NBP2-47506] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/Immunofluorescence: CLK2 Antibody [NBP2-47506] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CLK2 Antibody [NBP2-47506] - Staining of human colon tissue. Shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Glucosylceramidase/GBA
H00002629-M01
Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - GBA monoclonal antibody (M01), clone 2E2 Analysis of GBA expression in MCF-7.
Immunocytochemistry/Immunofluorescence: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml.
(1 Review)
(6 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NT-3 [Unconjugated]
267-N3
1 μg/lane of Recombinant Human NT-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human NT-3 (Catalog #267‑N3) stimulates cell proliferation in the BaF mouse pro-B cell line transfected with TrkB. The ED50 for this effect is 1-10 ng/mL.
(35 Publications)
Species: Hu
SCAMP2 Antibody
(OTI1H10)
NBP2-45688
Western Blot: SCAMP2 Antibody (1H10) [NBP2-45688] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SCAMP2.
Immunohistochemistry: SCAMP2 Antibody (1H10) [NBP2-45688] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: SCAMP2 Antibody (1H10) [NBP2-45688] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: WB, IHC
FAM189B Antibody
NBP1-88343
Western Blot: FAM189B Antibody [NBP1-88343] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: FAM189B Antibody [NBP1-88343] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FAM189B Antibody [NBP1-88343] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
VAMP-2 Antibody
NB300-595
Western Blot: VAMP-2 Antibody [NB300-595] - Analysis was performed on tissues (40 ug lysate) of Mouse Cerebellum (Lane 1), Mouse Brain (Lane 2) and Rat Brain (Lane 3).
Flow Cytometry: VAMP-2 Antibody [NB300-595] - Cells were fixed with 70% ethanol for 10 minutes, permeabilized with 0.25% Triton™ X-100 for 20 minutes, and blocked with 5% BSA for 30 minutes at room temperature.
Western Blot: VAMP-2 Antibody [NB300-595] - Analysis of rat brain extract.
(4 Publications)
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
OCT4 Antibody
NB100-2379
Western Blot: OCT4 Antibody [NB100-2379] - The expression of pluripotency factors Oct4 in human head and neck cancer cell lines.
Immunocytochemistry/Immunofluorescence: OCT4 Antibody [NB100-2379] - OCT4 staining in NTERA-2 cells detected with a Dylight 488 labeled secondary antibody.
Flow Cytometry: OCT4 Antibody [NB100-2379] - An intracellular stain was performed on Jurkat with OCT4 Antibody NB100-2379 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (SA5-10033, Thermo Fisher).
(8 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
HGS Antibody
NBP1-83202
Western Blot: HGS Antibody [NBP1-83202] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: HGS Antibody [NBP1-83202] - Staining of human cell line U-2 OS shows localization to cytosol & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HGS Antibody [NBP1-83202] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CCT3 Antibody
NBP1-86562
Western Blot: CCT3 Antibody [NBP1-86562] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-CCT3 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: CCT3 Antibody [NBP1-86562] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CCT3 Antibody [NBP1-86562] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
SOX2 Antibody
(245610) [Unconjugate
MAB2018
SOX2 was detected in immersion fixed BG01V human embryonic stem cells using Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
NTera‑2 human testicular embryonic carcinoma cell line was stained with Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005).  View our protocol for Staining Intracellular Molecules.
Western blot shows lysates of NTera‑2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, D3 mouse embryonic stem cell line, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(11 Reviews)
(81 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
GPATCH4 Knockout
293T Cell Lysate
NBP2-65972
GPATCH4 Knockout 293T Cell Lysate
Species: Hu
Myoglobin Antibody
(SC06-38)
NBP2-67599
Western Blot: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of Myoglobin on human skeletal muscle lysates using anti-Myoglobin antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Myoglobin Antibody (SC06-38) [NBP2-67599] - Staining Myoglobin in C2C12 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of paraffin-embedded mouse skeletal muscle tissue using anti-Myoglobin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MTCH1 Knockout
HeLa Cell Lysate
NBP2-65033
MTCH1 Knockout HeLa Cell Lysate
Species: Hu

Publications for SCAMP3 Partial Recombinant Protein (H00010067-Q01) (0)

There are no publications for SCAMP3 Partial Recombinant Protein (H00010067-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCAMP3 Partial Recombinant Protein (H00010067-Q01) (0)

There are no reviews for SCAMP3 Partial Recombinant Protein (H00010067-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCAMP3 Partial Recombinant Protein (H00010067-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SCAMP3 Partial Recombinant Protein (H00010067-Q01)

Discover related pathways, diseases and genes to SCAMP3 Partial Recombinant Protein (H00010067-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCAMP3 Partial Recombinant Protein (H00010067-Q01)

Discover more about diseases related to SCAMP3 Partial Recombinant Protein (H00010067-Q01).
 

Pathways for SCAMP3 Partial Recombinant Protein (H00010067-Q01)

View related products by pathway.

PTMs for SCAMP3 Partial Recombinant Protein (H00010067-Q01)

Learn more about PTMs related to SCAMP3 Partial Recombinant Protein (H00010067-Q01).

Blogs on SCAMP3

There are no specific blogs for SCAMP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SCAMP3 Recombinant Protein Antigen
NBP2-56966PEP
SOX2 was detected in immersion fixed BG01V human embryonic stem cells using Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
SOX2 Antibody (245610) [Unconjugated]
MAB2018
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line and K562 human chronic myelogenous leukemia cell line, HepG2 human hepatocellular carcinoma cell line, and JEG‑3 human epithelial choriocarcinoma cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse SCAMP3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5344) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for SCAMP3 at approximately 38 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SCAMP3 Antibody
AF5344
1 μg/lane of Recombinant Human NT-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
NT-3 [Unconjugated]
267-N3-005

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCAMP3 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SCAMP3
Entrez