Recombinant Human SCAMP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SCAMP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-329 of Human SCAMP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SCAMP2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCAMP2 Protein

  • secretory carrier membrane protein 2secretory carrier-associated membrane protein 2

Background

SCAMP2( AAH01376, 1 a.a. - 330 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79765
Species: Mu
Applications: WB
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5344
Species: Hu, Mu
Applications: WB
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-13284
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
NBP1-80996
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SCAMP2 Recombinant Protein (H00010066-P01) (0)

There are no publications for SCAMP2 Recombinant Protein (H00010066-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCAMP2 Recombinant Protein (H00010066-P01) (0)

There are no reviews for SCAMP2 Recombinant Protein (H00010066-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCAMP2 Recombinant Protein (H00010066-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCAMP2 Products

Bioinformatics Tool for SCAMP2 Recombinant Protein (H00010066-P01)

Discover related pathways, diseases and genes to SCAMP2 Recombinant Protein (H00010066-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCAMP2 Recombinant Protein (H00010066-P01)

Discover more about diseases related to SCAMP2 Recombinant Protein (H00010066-P01).
 

Pathways for SCAMP2 Recombinant Protein (H00010066-P01)

View related products by pathway.

PTMs for SCAMP2 Recombinant Protein (H00010066-P01)

Learn more about PTMs related to SCAMP2 Recombinant Protein (H00010066-P01).
 

Research Areas for SCAMP2 Recombinant Protein (H00010066-P01)

Find related products by research area.

Blogs on SCAMP2

There are no specific blogs for SCAMP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCAMP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCAMP2