SCAF1 Antibody

Images

 
Immunohistochemistry-Paraffin: SCAF1 Antibody [NBP1-94048] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCAF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKT
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCAF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCAF1 Protein (NBP1-94048PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCAF1 Antibody

  • FLJ00034
  • SCAF
  • serine arginine-rich pre-mRNA splicing factor SR-A1
  • SFRS19
  • splicing factor, arginine/serine-rich 19
  • SRA1
  • SR-related and CTD-associated factor 1
  • SR-related CTD-associated factor 1
  • SR-related-CTD-associated factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP3-03514
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
AF1444
Species: Mu
Applications: WB, IHC
MAB39102
Species: Hu
Applications: ICC
NBP1-32339
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-WhMt
H00051531-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-00092
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PLA
NBP2-16060
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24727
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
NBP2-01367
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-59845
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP2-57502
Species: Hu
Applications: ICC/IF
AF3075
Species: Hu
Applications: WB, Simple Western, ICC

Publications for SCAF1 Antibody (NBP1-94048) (0)

There are no publications for SCAF1 Antibody (NBP1-94048).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCAF1 Antibody (NBP1-94048) (0)

There are no reviews for SCAF1 Antibody (NBP1-94048). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCAF1 Antibody (NBP1-94048) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SCAF1 Products

Array NBP1-94048

Bioinformatics Tool for SCAF1 Antibody (NBP1-94048)

Discover related pathways, diseases and genes to SCAF1 Antibody (NBP1-94048). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SCAF1

There are no specific blogs for SCAF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCAF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCAF1