We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SC4MOL Recombinant Protein Antigen

Images

 
There are currently no images for SC4MOL Protein (NBP2-31624PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SC4MOL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MSMO1.

Source: E. coli

Amino Acid Sequence: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MSMO1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31624.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SC4MOL Recombinant Protein Antigen

  • C-4 methyl sterol
  • C-4 methylsterol oxidase
  • EC 1.14.13.72
  • ERG25DESP4Methylsterol monooxygenase
  • MGC104344
  • sterol-C4-methyl oxidase-like

Background

Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03109
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-93808
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-17029
Species: Hu, Mu, Rt
Applications: WB
NBP2-55973
Species: Hu
Applications: ICC/IF, WB
NBP2-84125
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-01170
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-48733
Species: Hu
Applications: ICC/IF,  IHC-P, KD, Simple Western, WB
NLS2666
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB110-58345
Species: Bv, Hu, Mu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-57758
Species: Hu
Applications: ICC/IF
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-49284
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-92011
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for SC4MOL Protein (NBP2-31624PEP) (0)

There are no publications for SC4MOL Protein (NBP2-31624PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SC4MOL Protein (NBP2-31624PEP) (0)

There are no reviews for SC4MOL Protein (NBP2-31624PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SC4MOL Protein (NBP2-31624PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SC4MOL Products

Blogs on SC4MOL

There are no specific blogs for SC4MOL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SC4MOL Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MSMO1