SAMD9L Antibody

Images

 
Immunohistochemistry: SAMD9L Antibody [NBP1-91243] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAMD9L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVDTIPKHSICNDKYFYIQMQICKDKIWKQNQNLSLFVREGASSRDILANSKQRDVDFKAFLQNLKSLVASRKEAEEEYGMKAMKKESEGLKLVKLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAMD9L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SAMD9L Protein (NBP1-91243PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAMD9L Antibody

  • DRIF2
  • FLJ39885
  • KIAA2005
  • sterile alpha motif domain containing 9-like
  • UEF
  • UEF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP1-87960
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-35213
Species: Hu
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-03020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91243
Species: Hu
Applications: IHC, IHC-P

Publications for SAMD9L Antibody (NBP1-91243) (0)

There are no publications for SAMD9L Antibody (NBP1-91243).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMD9L Antibody (NBP1-91243) (0)

There are no reviews for SAMD9L Antibody (NBP1-91243). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SAMD9L Antibody (NBP1-91243) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SAMD9L Products

Bioinformatics Tool for SAMD9L Antibody (NBP1-91243)

Discover related pathways, diseases and genes to SAMD9L Antibody (NBP1-91243). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAMD9L Antibody (NBP1-91243)

Discover more about diseases related to SAMD9L Antibody (NBP1-91243).
 

Pathways for SAMD9L Antibody (NBP1-91243)

View related products by pathway.

Blogs on SAMD9L

There are no specific blogs for SAMD9L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAMD9L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAMD9L