SAMD8 Antibody

Images

 
Western Blot: SAMD8 Antibody [NBP1-60113] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAMD8 Antibody Summary

Immunogen
Synthetic peptides corresponding to SAMD8(sterile alpha motif domain containing 8) The peptide sequence was selected from the middle region of SAMD8 (NP_653261). Peptide sequence MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAMD8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SAMD8 Antibody

  • FLJ25082
  • SAM domain-containing protein 8
  • SMSr
  • sphingomyelin synthase related
  • sphingomyelin synthase-related protein 1
  • sterile alpha motif domain containing 8
  • Sterile alpha motif domain-containing protein 8

Background

SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60004
Species: Hu, Mu
Applications: WB
NBP2-89107
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-62674
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP1-92038
Species: Hu
Applications: WB, IHC, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP2-30414
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47316
Species: Hu
Applications: WB (-), IHC, IP
NB120-11899
Species: Mu
Applications: WB, IHC, IHC-Fr
LBP
6445-LP/CF
Species: Hu
NBP2-15009
Species: Hu, Mu
Applications: WB
NBP2-58972
Species: Hu
Applications: WB, ICC/IF
NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB100-61625
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60113
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for SAMD8 Antibody (NBP1-60113) (0)

There are no publications for SAMD8 Antibody (NBP1-60113).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMD8 Antibody (NBP1-60113) (0)

There are no reviews for SAMD8 Antibody (NBP1-60113). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAMD8 Antibody (NBP1-60113) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SAMD8 Products

Bioinformatics Tool for SAMD8 Antibody (NBP1-60113)

Discover related pathways, diseases and genes to SAMD8 Antibody (NBP1-60113). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for SAMD8 Antibody (NBP1-60113)

Find related products by research area.

Blogs on SAMD8

There are no specific blogs for SAMD8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAMD8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAMD8
Entrez
Uniprot