ANKS3 Antibody

Images

 
Western Blot: ANKS3 Antibody [NBP1-83531] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ANKS3 Antibody [NBP1-83531] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ANKS3 Antibody [NBP1-83531] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKS3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:REEHAFCANLGPVQSSSSSEGLARAQGLSSEASVESNEDSDHACKSSARKQAKSYMKTKNPDSQWPPRTATDREGFLAESSPQTQRAPYSGPQD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKS3 Protein (NBP1-83531PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKS3 Antibody

  • ankyrin repeat and SAM domain-containing protein 3
  • ankyrin repeat and sterile alpha motif domain containing 3
  • FLJ32767
  • KIAA1977FLJ32345

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14181
Species: Hu
Applications: ICC/IF, IHC, IHC-P
870-LP/CF
Species: Hu
NBP2-15009
Species: Hu, Mu
Applications: WB
NBP2-58972
Species: Hu
Applications: WB, ICC/IF
NBP1-60113
Species: Hu
Applications: WB
NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76791
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58284
Species: Hu
Applications: WB, ICC/IF
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-92038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30414
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ANKS3 Antibody (NBP1-83531) (0)

There are no publications for ANKS3 Antibody (NBP1-83531).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKS3 Antibody (NBP1-83531) (0)

There are no reviews for ANKS3 Antibody (NBP1-83531). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ANKS3 Antibody (NBP1-83531) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKS3 Products

Bioinformatics Tool for ANKS3 Antibody (NBP1-83531)

Discover related pathways, diseases and genes to ANKS3 Antibody (NBP1-83531). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANKS3

There are no specific blogs for ANKS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKS3