Salivary Amylase Alpha Antibody [mFluor Violet 500 SE]

• Reactivity: Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: mFluor Violet 500 SE

Salivary Amylase Alpha Antibody [mFluor Violet 500 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 16-200 of human Salivary Amylase Alpha (NP_004029.2).
  
  Sequence:
  QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AMY1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Salivary Amylase Alpha Antibody [mFluor Violet 500 SE]

• 1,4-alpha-D-glucan glucanohydrolase 1
• alpha-amylase 1
• AMY1
• AMY1B
• AMY1C
• amylase, alpha 1A (salivary)
• amylase, alpha 1A; salivary
• amylase, salivary, alpha-1A
• EC 3.2.1.1
• glycogenase
• Salivary alpha-amylase
• salivary amylase alpha 1A

Background

Amylase catalyses the hydrolysis of internal 1,4 glucan links in large linear polymers at internal bonds. The enzyme is present in all living organisms with variable enzymatic activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AMY1A