S1P1/EDG-1 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S1P1/EDG-1. Source: E. coli Amino Acid Sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
S1PR1 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58024. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for S1P1/EDG-1 Recombinant Protein Antigen
Background
EBP 50 [ERM (ezrin-radixin-moesin) binding phosphoprotein of 50 kDa] is a PDZ containing protein that is involved in the linkage of integral membrane proteins to the cytoskeleton. EBP50 contains two tandem PDZ domains followed by a carboxy-terminal sequence that binds to members of the ERM family of membrane-cytoskeleton adaptors. The PDZ domains within EBP50 bind to the carboxy termini of such target proteins as beta2 adrenergic receptor, platelet-derived growth factor receptor (PDGFR), and the cystic fibrosis conductance regulator (CFTR). The PDZ domains are also believed to be involved in the oligomerization of EBP 50 to form multiprotein complexes which helps to facilitate the formation of functional signalling complexes. EBP 50 has been shown to link integral membrane proteins to the cytoskeleton by binding to members of the ERM family of proteins, which bind to F-actin. Through these interactions, EBP 50 is implicated in the localization of interactive groups of proteins into subcellular domains and in the regulation of activity of those interacting proteins. Immunohistochemical studies have shown that EBP 50 is found exclusively at the apical membranes of epithelial cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Ca, Hu, Mu, Pm, Rt, Xp
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Publications for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP) (0)
There are no publications for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP) (0)
There are no reviews for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP) (0)
Additional S1P1/EDG-1 Products
Research Areas for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP)
Find related products by research area.
|
Blogs on S1P1/EDG-1