S1P1/EDG-1 Recombinant Protein Antigen

Images

 
There are currently no images for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

S1P1/EDG-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S1P1/EDG-1.

Source: E. coli

Amino Acid Sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
S1PR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58024.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for S1P1/EDG-1 Recombinant Protein Antigen

  • CD363 antigen
  • CD363
  • CHEDG1
  • D1S3362
  • EDG1
  • EDG-1
  • EDG1edg-1
  • Endothelial differentiation G-protein coupled receptor 1
  • endothelial differentiation, sphingolipid G-protein-coupled receptor, 1
  • FLJ58121
  • S1P receptor 1
  • S1P receptor Edg-1
  • S1P1
  • S1P1ECGF1
  • S1PR1
  • sphingosine 1-phosphate receptor 1
  • sphingosine 1-phosphate receptor EDG1
  • Sphingosine 1-phosphate receptor Edg-1
  • sphingosine-1-phosphate receptor 1

Background

EBP 50 [ERM (ezrin-radixin-moesin) binding phosphoprotein of 50 kDa] is a PDZ containing protein that is involved in the linkage of integral membrane proteins to the cytoskeleton. EBP50 contains two tandem PDZ domains followed by a carboxy-terminal sequence that binds to members of the ERM family of membrane-cytoskeleton adaptors. The PDZ domains within EBP50 bind to the carboxy termini of such target proteins as beta2 adrenergic receptor, platelet-derived growth factor receptor (PDGFR), and the cystic fibrosis conductance regulator (CFTR). The PDZ domains are also believed to be involved in the oligomerization of EBP 50 to form multiprotein complexes which helps to facilitate the formation of functional signalling complexes. EBP 50 has been shown to link integral membrane proteins to the cytoskeleton by binding to members of the ERM family of proteins, which bind to F-actin. Through these interactions, EBP 50 is implicated in the localization of interactive groups of proteins into subcellular domains and in the regulation of activity of those interacting proteins. Immunohistochemical studies have shown that EBP 50 is found exclusively at the apical membranes of epithelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-05161
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-24762
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-26691
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-24712
Species: Ca, Hu, Mu, Pm, Rt, Xp
Applications: IHC,  IHC-P, WB
H00008877-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-03363
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC,  IHC-P
DVE00
Species: Hu
Applications: ELISA
NBP2-24500
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92389
Species: Hu
Applications: IHC,  IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NLS418
Species: Hu
Applications: IHC,  IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC

Publications for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP) (0)

There are no publications for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP) (0)

There are no reviews for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional S1P1/EDG-1 Products

Research Areas for S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP)

Find related products by research area.

Blogs on S1P1/EDG-1

There are no specific blogs for S1P1/EDG-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our S1P1/EDG-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol S1PR1