S100A9 Antibody (1C22)

Images

 
Western Blot: S100A9 Antibody (1C22) [H00006280-M13] - Analysis of S100A9 expression in transfected 293T cell line by S100A9 monoclonal antibody (M13), clone 1C22. Lane 1: S100A9 transfected lysatE (13.2 KDa). Lane 2: ...read more
Immunoprecipitation: S100A9 Antibody (1C22) [H00006280-M13] - Analysis of S100A9 transfected lysate using anti-S100A9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with S100A9 purified rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
1C22
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

S100A9 Antibody (1C22) Summary

Immunogen
S100A9 (AAH47681, 1 a.a. - 114 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
S100A9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
It has been used for ELISA, WB and IP.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A9 Antibody (1C22)

  • CAGBMigration inhibitory factor-related protein 14
  • Calgranulin B
  • calgranulin-B
  • Calprotectin L1H subunit
  • CFAGMRP-14,60B8AG
  • CGLB
  • L1AG
  • LIAG
  • MAC387
  • MIF
  • MRP-14
  • MRP14Leukocyte L1 complex heavy chain
  • NIF
  • P14
  • protein S100-A9
  • S100 calcium binding protein A9 (calgranulin B)
  • S100 calcium binding protein A9
  • S100 calcium-binding protein A9 (calgranulin B)
  • S100 calcium-binding protein A9
  • S100A9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for S100A9 Antibody (H00006280-M13) (0)

There are no publications for S100A9 Antibody (H00006280-M13).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A9 Antibody (H00006280-M13) (0)

There are no reviews for S100A9 Antibody (H00006280-M13). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A9 Antibody (H00006280-M13). (Showing 1 - 2 of 2 FAQ).

  1. Have any of your S100A9 antibodies been tested for use in neutralization, or blocking assays, on human samples?
    • Unfortunately at this time we have not tested, or received customer feedback on our S100A9 antibodies for use in blocking or neutralizing assays. If you were planning on testing any of our S100A9 antibodies for neutralizing or blocking capabilities, we would recommend our Innovator’s Reward Program. Under the terms of this program we would be happy to provide a credit for a free vial in exchange for new data on this previously untested or reported application. Please submit this data in the form of an online review. Additional <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a> information can be found using this link.
  2. We would like to stain paraffin embedded human intestinal tissue for Calprotectin. One question will be which cells express the majority of Calprotectin - invading neutrophils vs epithelium for example. The antibody list you provide is quite extensive. Which antibody would you recommend for our purpose? Which tissue would you recommend as positive control.
    • Nine of our antibodies to Calprotectin have been validated for IHC-P with human tissue, and you can see all of these products. A number of our IHC images were generated using human spleen samples, and as such this may be a good choice of a positive control tissue. We do sell a human spleen slide product, which is suitable for IHC-P. Unfortunately I do not have an in-depth knowledge of Calprotectin, however the image shown for our antibody with catalogue number NBP1-02826 demonstrates clear staining of neutrophils. The following paper also suggests that the protein is abundant in neutrophils: PMID 11435495.

Secondary Antibodies

 

Isotype Controls

Additional S100A9 Products

Bioinformatics Tool for S100A9 Antibody (H00006280-M13)

Discover related pathways, diseases and genes to S100A9 Antibody (H00006280-M13). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A9 Antibody (H00006280-M13)

Discover more about diseases related to S100A9 Antibody (H00006280-M13).
 

Pathways for S100A9 Antibody (H00006280-M13)

View related products by pathway.

PTMs for S100A9 Antibody (H00006280-M13)

Learn more about PTMs related to S100A9 Antibody (H00006280-M13).
 

Research Areas for S100A9 Antibody (H00006280-M13)

Find related products by research area.

Blogs on S100A9

There are no specific blogs for S100A9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A9 Antibody (1C22) and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A9
Entrez
Uniprot