S100A11 Antibody (1B12) - Azide and BSA Free

Sandwich ELISA: S100A11 Antibody (1B12) [H00006282-M17] - Detection limit for recombinant GST tagged S100A11 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1B12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

S100A11 Antibody (1B12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: S100A11 (AAH14354.1, 10 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGL
• Specificity: S100A11 - S100 calcium binding protein A11 (calgizzarin) (1B12)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: S100A11
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A11 Antibody (1B12) - Azide and BSA Free

• Calgizzarin
• Metastatic lymph node gene 70 protein
• MLN 70
• MLN70
• protein S100-A11
• Protein S100-C
• S100 calcium binding protein A11
• S100 calcium-binding protein A11 (calgizzarin)
• S100 calcium-binding protein A11
• S100A11
• S100C
• S100CS100 calcium binding protein A11 (calgizzarin)

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S100A11
• Entrez:
  • 6282(Human)
• Uniprot:
  • AAH14354(Human)