S100A11 Antibody (1B12)


Sandwich ELISA: S100A11 Antibody (1B12) [H00006282-M17] - Detection limit for recombinant GST tagged S100A11 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

S100A11 Antibody (1B12) Summary

S100A11 (AAH14354.1, 10 a.a. - 87 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGL
S100A11 - S100 calcium binding protein A11 (calgizzarin) (1B12)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A11 Antibody (1B12)

  • Calgizzarin
  • Metastatic lymph node gene 70 protein
  • MLN 70
  • MLN70
  • protein S100-A11
  • Protein S100-C
  • S100 calcium binding protein A11
  • S100 calcium-binding protein A11 (calgizzarin)
  • S100 calcium-binding protein A11
  • S100A11
  • S100C
  • S100CS100 calcium binding protein A11 (calgizzarin)


The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, Simple Western, ICC
Species: Mu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ELISA

Publications for S100A11 Antibody (H00006282-M17) (0)

There are no publications for S100A11 Antibody (H00006282-M17).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A11 Antibody (H00006282-M17) (0)

There are no reviews for S100A11 Antibody (H00006282-M17). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A11 Antibody (H00006282-M17) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional S100A11 Products

Bioinformatics Tool for S100A11 Antibody (H00006282-M17)

Discover related pathways, diseases and genes to S100A11 Antibody (H00006282-M17). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A11 Antibody (H00006282-M17)

Discover more about diseases related to S100A11 Antibody (H00006282-M17).

Pathways for S100A11 Antibody (H00006282-M17)

View related products by pathway.

PTMs for S100A11 Antibody (H00006282-M17)

Learn more about PTMs related to S100A11 Antibody (H00006282-M17).

Research Areas for S100A11 Antibody (H00006282-M17)

Find related products by research area.

Blogs on S100A11

There are no specific blogs for S100A11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our S100A11 Antibody (1B12) and receive a gift card or discount.


Gene Symbol S100A11