We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RUVBL2 Recombinant Protein Antigen

Images

 
There are currently no images for RUVBL2 Recombinant Protein Antigen (NBP2-55231PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RUVBL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to RUVBL2.

Source: E. coli

Amino Acid Sequence: MSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RUVBL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55231.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RUVBL2 Recombinant Protein Antigen

  • 48 kDa TATA box-binding protein-interacting protein
  • 51 kDa erythrocyte cytosolic protein
  • EC 3.6.1
  • EC 3.6.4.12,48 kDa TBP-interacting protein
  • ECP51TIP49B
  • erythrocyte cytosolic protein, 51-KD
  • INO80 complex subunit J
  • INO80JTAP54-beta
  • Repressing pontin 52
  • Reptin 52
  • REPTIN
  • Reptin52
  • RuvB (E coli homolog)-like 2
  • RuvB-like 2 (E. coli)
  • ruvB-like 2
  • Rvb2
  • TBP-interacting protein, 48-KD
  • TIH2
  • TIP48ECP-51
  • TIP49b
  • TIP60-associated protein 54-beta

Background

RUVBL2 encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20245
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-85482
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-78759
Species: Hu
Applications: IP, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-16797
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-32732
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC,  IHC-P, IP, WB
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP1-89850
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-61628
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP (-), Simple Western, WB
NBP1-84063
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
NBP1-80683
Species: Hu
Applications: IHC,  IHC-P
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF3760
Species: Hu
Applications: WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for RUVBL2 Recombinant Protein Antigen (NBP2-55231PEP) (0)

There are no publications for RUVBL2 Recombinant Protein Antigen (NBP2-55231PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUVBL2 Recombinant Protein Antigen (NBP2-55231PEP) (0)

There are no reviews for RUVBL2 Recombinant Protein Antigen (NBP2-55231PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RUVBL2 Recombinant Protein Antigen (NBP2-55231PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RUVBL2 Products

Research Areas for RUVBL2 Recombinant Protein Antigen (NBP2-55231PEP)

Find related products by research area.

Blogs on RUVBL2

There are no specific blogs for RUVBL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RUVBL2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RUVBL2