RUVBL1 Recombinant Protein Antigen

Images

 
There are currently no images for RUVBL1 Protein (NBP1-84914PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RUVBL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RUVBL1.

Source: E. coli

Amino Acid Sequence: GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RUVBL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84914.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RUVBL1 Recombinant Protein Antigen

  • 49 kDa TATA box-binding protein-interacting protein
  • 54 kDa erythrocyte cytosolic protein
  • EC 3.6.1
  • EC 3.6.4.12,49 kDa TBP-interacting protein
  • ECP54
  • INO80 complex subunit H
  • INO80HTIP49A
  • NMP 238
  • NMP238ECP-54
  • Nuclear matrix protein 238
  • Pontin 52
  • PONTIN
  • Pontin52
  • RuvB (E coli homolog)-like 1
  • RuvB-like 1 (E. coli)
  • ruvB-like 1
  • RVB1
  • TATA binding protein interacting protein 49 kDa
  • TIH1
  • TIP49a
  • TIP49TAP54-alpha
  • TIP60-associated protein 54-alpha

Background

Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (3' to 5') activity. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. RUVBL1 plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-40354
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-24613
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-78759
Species: Hu
Applications: IP, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-84063
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP1-32732
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC,  IHC-P, IP, WB
NB100-61628
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP (-), Simple Western, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-88561
Species: Hu
Applications: IHC,  IHC-P, WB
AF3760
Species: Hu
Applications: WB
2695-SE
Species: Hu
Applications: EnzAct
H00023049-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-84914PEP
Species: Hu
Applications: AC

Publications for RUVBL1 Protein (NBP1-84914PEP) (0)

There are no publications for RUVBL1 Protein (NBP1-84914PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUVBL1 Protein (NBP1-84914PEP) (0)

There are no reviews for RUVBL1 Protein (NBP1-84914PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RUVBL1 Protein (NBP1-84914PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RUVBL1 Products

Research Areas for RUVBL1 Protein (NBP1-84914PEP)

Find related products by research area.

Blogs on RUVBL1

There are no specific blogs for RUVBL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RUVBL1 Antibody
NBP2-20245

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RUVBL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RUVBL1