RUNX1T1/ETO Antibody - BSA Free

Immunohistochemistry-Paraffin: RUNX1T1/ETO Antibody [NBP3-09370] - Immunohistochemical analysis of formalin-fixed paraffin-embedded hepatocyte nuclei in human liver tissue using NBP3-09370 at a dilution of 1:100. Donkey anti-Rabbit-Cy3 used as a secondary antibody at a dilution of 1:200. 20X magnification.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RUNX1T1/ETO Antibody - BSA Free Summary

• Immunogen: A synthetic peptide directed towards the middle region of human RUNX1T1/ETO. Peptide sequence: CGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTP.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RUNX1T1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RUNX1T1/ETO Antibody - BSA Free

• AML1T1protein CBFA2T1
• CBFA2T1Cyclin-D-related protein
• CDRMGC2796
• core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related
• DKFZp564B213
• Eight twenty one protein
• ETOFLJ33145
• MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related
• Protein ETO
• Protein MTG8
• runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
• Zinc finger MYND domain-containing protein 2
• ZMYND2myeloid translocation gene on 8q22

Background

RUNX1T1 / ETO is encoded by this gene is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Several transcript variants encoding multiple isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RUNX1T1