RUBCNL Antibody

Images

 
Western Blot: RUBCNL Antibody [NBP2-88199] - Host: Rabbit. Target Name: C13ORF18. Sample Tissue: Human HT1080 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RUBCNL Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RUBCNL. Peptide sequence: SQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RUBCNL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RUBCNL Antibody

  • C13orf18
  • KIAA0226L
  • KIAA0226-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1213
Species: Mu
Applications: WB, IHC, Block, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-317
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-02902
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-59451
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, MiAr
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
NBP1-88826
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-72965
Species: Hu, Mu, Rt
Applications: WB
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP2-73624
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-00817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58997
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24643
Species: Mu, Rt
Applications: WB
NBP1-81734
Species: Hu, Mu, Rt, Dr
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP3-04411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-88199
Species: Hu
Applications: WB

Publications for RUBCNL Antibody (NBP2-88199) (0)

There are no publications for RUBCNL Antibody (NBP2-88199).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUBCNL Antibody (NBP2-88199) (0)

There are no reviews for RUBCNL Antibody (NBP2-88199). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RUBCNL Antibody (NBP2-88199) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RUBCNL Products

Bioinformatics Tool for RUBCNL Antibody (NBP2-88199)

Discover related pathways, diseases and genes to RUBCNL Antibody (NBP2-88199). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RUBCNL Antibody (NBP2-88199)

Find related products by research area.

Blogs on RUBCNL

There are no specific blogs for RUBCNL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUBCNL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RUBCNL