RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free

Western Blot: RTVP-1/GLIPR1 Antibody (8D9) [H00011010-M04] - Analysis of GLIPR1 expression in HeLa(Cat # L013V1).

Sandwich ELISA: RTVP-1/GLIPR1 Antibody (8D9) [H00011010-M04] - Detection limit for recombinant GST tagged GLIPR1 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 8D9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free Summary

• Immunogen: GLIPR1 (NP_006842, 23 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GLIPR1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free

• GLI pathogenesis-related 1 (glioma)
• GLI pathogenesis-related 1
• GliPR 1
• GliPR
• GLIPR1
• GLIPRglioma pathogenesis-related protein 1
• Protein RTVP-1
• related to testis-specific, vespid, and pathogenesis proteins 1
• RTVP1
• RTVP-1
• RTVP1CRISP7
• testes-specific vespid and pathogenesis protein 1

Background

The protein encoded by the GLIPR1 gene works as a proapoptic initiator in prostate and bladder cells. Not all variants of the GLIPR1 gene have been documented even though multiple isoforms have been described (isoform 1: 255 AA long, 30 kDA; isoform 2: 237 AA long, nearly 30 kDA). The glioma pathogenesis-related protein 1 provided by the GLIPR1 gene is related to both the pathogenesis-related protein (PR) superfamily as well as the cysteine-rich secretory protein (CRISP) family. GLIPR1 has been research regarding its role in Wilms tumors, neuronitis, prostatitis, leukemia, glioblastoma, astrocytoma where increased expression has been linked with myelomocytic differentiation in macrophage and decreased expression (through gene methylation) has been associated to prostate cancer. The GLIPR1 gene interacts with genes CHD9, NCOA2, NCOA6, CREBBP, and CARM1 to participate in metabolism, expression of GLIPR1 and PPARA activation gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RTVP-1/GLIPR1 Antibody (H00011010-M04)(1)

Publication using H00011010-M04

• Urban S, Steffi R, Daniel M et al. GliPR1 knockdown by RNA interference exerts anti-glioma effects in vitro and in vivo. J Neurooncol. 2021-04-15 [PMID: 33856615]

Bioinformatics

• Gene Symbol: GLIPR1
• Uniprot:
  • NP_006842(Human)