RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free Summary
| Immunogen |
GLIPR1 (NP_006842, 23 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
GLIPR1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
| Application Notes |
This antibody is useful for ELISA, Western Blot |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RTVP-1/GLIPR1 Antibody (8D9) - Azide and BSA Free
Background
The protein encoded by the GLIPR1 gene works as a proapoptic initiator in prostate and bladder cells. Not all variants of the GLIPR1 gene have been documented even though multiple isoforms have been described (isoform 1: 255 AA long, 30 kDA; isoform 2: 237 AA long, nearly 30 kDA). The glioma pathogenesis-related protein 1 provided by the GLIPR1 gene is related to both the pathogenesis-related protein (PR) superfamily as well as the cysteine-rich secretory protein (CRISP) family. GLIPR1 has been research regarding its role in Wilms tumors, neuronitis, prostatitis, leukemia, glioblastoma, astrocytoma where increased expression has been linked with myelomocytic differentiation in macrophage and decreased expression (through gene methylation) has been associated to prostate cancer. The GLIPR1 gene interacts with genes CHD9, NCOA2, NCOA6, CREBBP, and CARM1 to participate in metabolism, expression of GLIPR1 and PPARA activation gene expression.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, WB
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: IHC, WB
Publications for RTVP-1/GLIPR1 Antibody (H00011010-M04)(1)
Showing Publication 1 -
1 of 1.
Reviews for RTVP-1/GLIPR1 Antibody (H00011010-M04) (0)
There are no reviews for RTVP-1/GLIPR1 Antibody (H00011010-M04).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RTVP-1/GLIPR1 Antibody (H00011010-M04) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RTVP-1/GLIPR1 Products
Research Areas for RTVP-1/GLIPR1 Antibody (H00011010-M04)
Find related products by research area.
|
Blogs on RTVP-1/GLIPR1