RSK1 Antibody (2E3)

Western Blot: RSK1 Antibody (2E3.) [H00006195-M01] - Detection against Immunogen (34.25 KDa) .

Product Discontinued

RSK1 Antibody (2E3) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: RPS6KA1 (NP_002944, 342 a.a. ~ 416 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSD
• Specificity: RPS6KA1 (2E3)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RPS6KA1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RSK1 Antibody (2E3)

• 90kD, polypeptide 1)
• EC 2.7.11
• EC 2.7.11.1,90 kDa ribosomal protein S6 kinase 1
• HU-1
• MAP kinase-activated protein kinase 1a
• MAPK-activated protein kinase 1a
• MAPKAP kinase 1a
• MAPKAPK-1a
• MAPKAPL1A
• p90RSK1
• p90S6K
• ribosomal protein S6 kinase alpha 1
• ribosomal protein S6 kinase alpha-1
• ribosomal protein S6 kinase, 90kD, polypeptide 1
• ribosomal protein S6 kinase, 90kDa, polypeptide 1
• Ribosomal S6 kinase 1
• RPS6KA1
• RSK
• RSK1
• RSK-1
• RSK1p90-RSK 1
• S6K-alpha 1
• S6K-alpha-1

Background

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPS6KA1
• Entrez:
  • 6195(Human)
• OMIM:
  • 601684(Human)
• Uniprot:
  • NP_002944(Human)