RSK1 Antibody (2E3)


Western Blot: RSK1 Antibody (2E3.) [H00006195-M01] - Detection against Immunogen (34.25 KDa) .

Product Details

Product Discontinued
View other related RSK1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RSK1 Antibody (2E3) Summary

Quality control test: Antibody Reactive Against Recombinant Protein.
RPS6KA1 (NP_002944, 342 a.a. ~ 416 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSD
RPS6KA1 (2E3)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RSK1 Antibody (2E3)

  • 90kD, polypeptide 1)
  • EC 2.7.11
  • EC,90 kDa ribosomal protein S6 kinase 1
  • HU-1
  • MAP kinase-activated protein kinase 1a
  • MAPK-activated protein kinase 1a
  • MAPKAP kinase 1a
  • MAPKAPK-1a
  • p90RSK1
  • p90S6K
  • ribosomal protein S6 kinase alpha 1
  • ribosomal protein S6 kinase alpha-1
  • ribosomal protein S6 kinase, 90kD, polypeptide 1
  • ribosomal protein S6 kinase, 90kDa, polypeptide 1
  • Ribosomal S6 kinase 1
  • RPS6KA1
  • RSK
  • RSK1
  • RSK-1
  • RSK1p90-RSK 1
  • S6K-alpha 1
  • S6K-alpha-1


This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: WB, ELISA

Publications for RSK1 Antibody (H00006195-M01) (0)

There are no publications for RSK1 Antibody (H00006195-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSK1 Antibody (H00006195-M01) (0)

There are no reviews for RSK1 Antibody (H00006195-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RSK1 Antibody (H00006195-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RSK1 Products

Diseases for RSK1 Antibody (H00006195-M01)

Discover more about diseases related to RSK1 Antibody (H00006195-M01).

Pathways for RSK1 Antibody (H00006195-M01)

View related products by pathway.

PTMs for RSK1 Antibody (H00006195-M01)

Learn more about PTMs related to RSK1 Antibody (H00006195-M01).

Research Areas for RSK1 Antibody (H00006195-M01)

Find related products by research area.

Blogs on RSK1

There are no specific blogs for RSK1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RSK1 Antibody (2E3) and receive a gift card or discount.


Gene Symbol RPS6KA1