RSBN1 Antibody - BSA Free

Western Blot: RSBN1 Antibody [NBP1-57724] - Human Lung lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RSBN1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RSBN1 (round spermatid basic protein 1) The peptide sequence was selected from the N terminal of RSBN1)(50ug). Peptide sequence GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RSBN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Knockdown Validated
  • Western Blot 1.0 ug/ml
• Application Notes: Use in KD reported in scientific literature (PMID:34526665).

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33760197).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RSBN1 Antibody - BSA Free

• DKFZp781E21150
• FLJ11220
• ROSBIN
• round spermatid basic protein 1
• RP11-324J2.1

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RSBN1 Antibody (NBP1-57724)(2)

Publications using NBP1-57724

• Iden M, Tsaih SW, Huang YW et al. Multi-omics mapping of human papillomavirus integration sites illuminates novel cervical cancer target genes Br J Cancer 2021-09-15 [PMID: 34526665] (KD, WB, Human)
  
  Details:
  Citation using the Azide and BSA Free format of this antibody.
• Sun H, Shi Y, Shang Y et al. MicroRNA 378d inhibits Glut4 by targeting Rsbn1 in vitamin D deficient ovarian granulosa cells Molecular medicine reports 2021-05-01 [PMID: 33760197] (WB, Mouse)

Bioinformatics

• Gene Symbol: RSBN1
• Uniprot:
  • Q5VWQ0(Human)