RPTN Recombinant Protein Antigen

Images

 
There are currently no images for RPTN Protein (NBP2-38159PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RPTN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPTN.

Source: E.coli

Amino Acid Sequence: ETVETILNLLDQDRDGHIDFHEYLLLVFQLVQACYHKLDNKSHGGRTSQQERGQEGAQDCKFPGNTGRQHRQRHEEERQNSHHSQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPTN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38159.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RPTN Recombinant Protein Antigen

  • FLJ39117
  • intermediate filament-associated protein
  • repetin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
AF3844
Species: Hu, Mu
Applications: IHC
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP1-80687
Species: Hu
Applications: IHC, IHC-P
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051360-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00028986-P01
Species: Hu
NBP1-88479
Species: Hu
Applications: IHC, IHC-P
NBP2-37892
Species: Hu
Applications: IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, KO
NBP1-89409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80807
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPTN Protein (NBP2-38159PEP) (0)

There are no publications for RPTN Protein (NBP2-38159PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPTN Protein (NBP2-38159PEP) (0)

There are no reviews for RPTN Protein (NBP2-38159PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for RPTN Protein (NBP2-38159PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP2-38159PEP

Bioinformatics Tool for RPTN Protein (NBP2-38159PEP)

Discover related pathways, diseases and genes to RPTN Protein (NBP2-38159PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPTN Protein (NBP2-38159PEP)

Discover more about diseases related to RPTN Protein (NBP2-38159PEP).
 

Pathways for RPTN Protein (NBP2-38159PEP)

View related products by pathway.

PTMs for RPTN Protein (NBP2-38159PEP)

Learn more about PTMs related to RPTN Protein (NBP2-38159PEP).

Blogs on RPTN

There are no specific blogs for RPTN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141
RPTN Antibody
NBP1-93792

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RPTN Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPTN