RPS5 Antibody - BSA Free

Western Blot: RPS5 Antibody [NBP2-49198] - Analysis using Anti-RPS5 antibody NBP2-49198 (A) shows similar pattern to independent antibody NBP2-56843 (B).

Immunocytochemistry/Immunofluorescence: RPS5 Antibody [NBP2-49198] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & endoplasmic reticulum.

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human colon.

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-RPS5 antibody NBP2-49198 (A) shows similar protein distribution across tissues to independent antibody NBP2-56843 (B).

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human lymph node.

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPS5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RPS5 Antibody - BSA Free (NBP2-49198) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA
• Predicted Species: Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPS5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPS5 Recombinant Protein Antigen (NBP2-49198PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RPS5 Antibody - BSA Free

• ribosomal protein S5,40S ribosomal protein S5

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7P family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPS5