RPS27L Antibody

Images

 
Western Blot: RPS27L Antibody [NBP2-85672] - Host: Rabbit. Target Name: Rps27l. Sample Type: Rat Lung lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS27L Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat RPS27L. Peptide sequence: YFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RPS27L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPS27L Antibody

  • 40S ribosomal protein S27-like
  • ribosomal protein S27-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1103
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
NBP2-67484
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-23368
Species: Hu
Applications: PAGE
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20210
Species: Hu, I, Mu
Applications: IHC, IHC-P, WB
NBP2-92441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-13555
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-88446
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32724
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-85672
Species: Rt
Applications: WB

Publications for RPS27L Antibody (NBP2-85672) (0)

There are no publications for RPS27L Antibody (NBP2-85672).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS27L Antibody (NBP2-85672) (0)

There are no reviews for RPS27L Antibody (NBP2-85672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPS27L Antibody (NBP2-85672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS27L Products

Bioinformatics Tool for RPS27L Antibody (NBP2-85672)

Discover related pathways, diseases and genes to RPS27L Antibody (NBP2-85672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS27L Antibody (NBP2-85672)

Discover more about diseases related to RPS27L Antibody (NBP2-85672).
 

Pathways for RPS27L Antibody (NBP2-85672)

View related products by pathway.

PTMs for RPS27L Antibody (NBP2-85672)

Learn more about PTMs related to RPS27L Antibody (NBP2-85672).
 

Research Areas for RPS27L Antibody (NBP2-85672)

Find related products by research area.

Blogs on RPS27L

There are no specific blogs for RPS27L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS27L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS27L