RPS15 Antibody


Independent Antibodies: Western Blot: RPS15 Antibody [NBP2-33717] - Analysis using Anti-RPS15 antibody NBP2-33717 (A) shows similar pattern to independent antibody NBP2-34083 (B).
Immunocytochemistry/ Immunofluorescence: RPS15 Antibody [NBP2-33717] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human liver.
Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human pancreas shows strong cytoplasmic and nucleolar positivity in exocrine glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human cerebral cortex, colon, liver and pancreas using Anti-RPS15 antibody NBP2-33717 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human colon.
Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human pancreas.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Independent Antibodies


Order Details

RPS15 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQH
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPS15 Protein (NBP2-33717PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RPS15 Antibody

  • 40S ribosomal protein S15
  • homolog of rat insulinoma
  • MGC111130
  • ribosomal protein S15
  • RIG protein
  • RIGinsulinoma protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ChIP, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: Flow, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB

Publications for RPS15 Antibody (NBP2-33717) (0)

There are no publications for RPS15 Antibody (NBP2-33717).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS15 Antibody (NBP2-33717) (0)

There are no reviews for RPS15 Antibody (NBP2-33717). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS15 Antibody (NBP2-33717) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RPS15 Products

Array NBP2-33717

Bioinformatics Tool for RPS15 Antibody (NBP2-33717)

Discover related pathways, diseases and genes to RPS15 Antibody (NBP2-33717). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS15 Antibody (NBP2-33717)

Discover more about diseases related to RPS15 Antibody (NBP2-33717).

Pathways for RPS15 Antibody (NBP2-33717)

View related products by pathway.

PTMs for RPS15 Antibody (NBP2-33717)

Learn more about PTMs related to RPS15 Antibody (NBP2-33717).

Blogs on RPS15

There are no specific blogs for RPS15, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RPS15 Antibody and receive a gift card or discount.


Gene Symbol RPS15