Recombinant Human RPP40 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human RPP40 Protein [H00010799-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human RPP40 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 295-363 of Human RPP40

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPP40
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
33.33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPP40 GST (N-Term) Protein

  • bA428J1.3,40kD subunit
  • EC 3.1.26.5
  • ribonuclease P/MRP 40kDa subunit
  • RNaseP protein p40

Background

RPP40 - ribonuclease P 40kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57072
Species: Hu, Mu
Applications: WB
NBP1-92282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93628
Species: Mu, Rt
Applications: WB
NBP2-93109
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-13260
Species: Hu
Applications: WB, ICC/IF, KD
NBP1-80658
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
NBP1-92349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56076
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
AF4986
Species: Hu
Applications: WB
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO

Publications for RPP40 Partial Recombinant Protein (H00010799-Q01) (0)

There are no publications for RPP40 Partial Recombinant Protein (H00010799-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPP40 Partial Recombinant Protein (H00010799-Q01) (0)

There are no reviews for RPP40 Partial Recombinant Protein (H00010799-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPP40 Partial Recombinant Protein (H00010799-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional RPP40 Products

Bioinformatics Tool for RPP40 Partial Recombinant Protein (H00010799-Q01)

Discover related pathways, diseases and genes to RPP40 Partial Recombinant Protein (H00010799-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPP40 Partial Recombinant Protein (H00010799-Q01)

Discover more about diseases related to RPP40 Partial Recombinant Protein (H00010799-Q01).
 

Pathways for RPP40 Partial Recombinant Protein (H00010799-Q01)

View related products by pathway.

PTMs for RPP40 Partial Recombinant Protein (H00010799-Q01)

Learn more about PTMs related to RPP40 Partial Recombinant Protein (H00010799-Q01).
 

Research Areas for RPP40 Partial Recombinant Protein (H00010799-Q01)

Find related products by research area.

Blogs on RPP40

There are no specific blogs for RPP40, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HSP27 Antibody
NBP1-75477

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPP40 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPP40