Recombinant Human RPP40 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPP40 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 295-363 of Human RPP40 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPP40
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPP40 Protein

  • bA428J1.3,40kD subunit
  • EC 3.1.26.5
  • ribonuclease P/MRP 40kDa subunit
  • RNaseP protein p40

Background

RPP40 - ribonuclease P 40kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13789
Species: Hu
Applications: IHC, IHC-P
NBP1-92282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26606
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP, ICC
NBP1-92281
Species: Hu
Applications: WB, IHC, IHC-P
H00010557-R03
Species: Hu
NBP1-80658
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-92349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31890
Species: Hu
Applications: IHC
NB100-56076
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-P, IP
NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
AF4986
Species: Hu
Applications: WB
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for RPP40 Partial Recombinant Protein (H00010799-Q01) (0)

There are no publications for RPP40 Partial Recombinant Protein (H00010799-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPP40 Partial Recombinant Protein (H00010799-Q01) (0)

There are no reviews for RPP40 Partial Recombinant Protein (H00010799-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPP40 Partial Recombinant Protein (H00010799-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPP40 Products

Bioinformatics Tool for RPP40 Partial Recombinant Protein (H00010799-Q01)

Discover related pathways, diseases and genes to RPP40 Partial Recombinant Protein (H00010799-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPP40 Partial Recombinant Protein (H00010799-Q01)

Discover more about diseases related to RPP40 Partial Recombinant Protein (H00010799-Q01).
 

Pathways for RPP40 Partial Recombinant Protein (H00010799-Q01)

View related products by pathway.

PTMs for RPP40 Partial Recombinant Protein (H00010799-Q01)

Learn more about PTMs related to RPP40 Partial Recombinant Protein (H00010799-Q01).
 

Research Areas for RPP40 Partial Recombinant Protein (H00010799-Q01)

Find related products by research area.

Blogs on RPP40

There are no specific blogs for RPP40, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MRP1 Antibody (IU2H10)
NB400-156-0.1ml
RPP40 Antibody
NBP1-88765
HSP27 Antibody (G3.1)
NBP2-32972-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPP40 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPP40