RPL7 Antibody (2E10.)

Images

 
Immunocytochemistry/ Immunofluorescence: RPL7 Antibody (2E10) [H00006129-M06] - Analysis of monoclonal antibody to RPL7 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: RPL7 Antibody (2E10) [H00006129-M06] - Detection limit for recombinant GST tagged RPL7 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
2E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPL7 Antibody (2E10.) Summary

Immunogen
RPL7 (NP_000962.2 158 a.a. - 248 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN
Specificity
RPL7 - ribosomal protein L7 (2E10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPL7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPL7 Antibody (2E10.)

  • humL7-1,60S ribosomal protein L7
  • MGC117326
  • ribosomal protein L7

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30P family of ribosomal proteins. It contains an N-terminal basic region-leucine zipper (BZIP)-like domain and the RNP consensus submotif RNP2. In vitro the BZIP-like domain mediates homodimerization and stable binding to DNA and RNA, with a preference for 28S rRNA and mRNA. The protein can inhibit cell-free translation of mRNAs, suggesting that it plays a regulatory role in the translation apparatus. It is located in the cytoplasm. The protein has been shown to be an autoantigen in patients with systemic autoimmune diseases, such as systemic lupus erythematosus. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00028299-P01
Species: Hu
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPL7 Antibody (H00006129-M06) (0)

There are no publications for RPL7 Antibody (H00006129-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL7 Antibody (H00006129-M06) (0)

There are no reviews for RPL7 Antibody (H00006129-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPL7 Antibody (H00006129-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL7 Products

Bioinformatics Tool for RPL7 Antibody (H00006129-M06)

Discover related pathways, diseases and genes to RPL7 Antibody (H00006129-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL7 Antibody (H00006129-M06)

Discover more about diseases related to RPL7 Antibody (H00006129-M06).
 

Pathways for RPL7 Antibody (H00006129-M06)

View related products by pathway.

PTMs for RPL7 Antibody (H00006129-M06)

Learn more about PTMs related to RPL7 Antibody (H00006129-M06).
 

Research Areas for RPL7 Antibody (H00006129-M06)

Find related products by research area.

Blogs on RPL7

There are no specific blogs for RPL7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL7 Antibody (2E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL7
Entrez
Uniprot