RPL4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RPL4 Antibody [NBP1-81329] - Staining of human cell line A-431 shows localization to nuclear bodies, cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPL4 Antibody [NBP1-81329] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine pancreas.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPT
Specificity
Specificity of human RPL4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP1-81329 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL4 Antibody

  • ribosomal protein L4,60S ribosomal protein L1,60S ribosomal protein L4
  • RPL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu, Po, Bv, Ca, Eq, Rb
Applications: WB
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-06069
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
CD6
627-CD
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-81329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RPL4 Antibody (NBP1-81329) (0)

There are no publications for RPL4 Antibody (NBP1-81329).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for RPL4 Antibody (NBP1-81329) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-81329:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot RPL4 NBP1-81329
Enlarge
reviewed by:
Anonymous
WB Human 07/20/2018
View

Summary

ApplicationWestern Blot
Sample TestedHepG2
SpeciesHuman
LotA97119

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPL4 Antibody (NBP1-81329) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPL4 Products

Bioinformatics Tool for RPL4 Antibody (NBP1-81329)

Discover related pathways, diseases and genes to RPL4 Antibody (NBP1-81329). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL4 Antibody (NBP1-81329)

Discover more about diseases related to RPL4 Antibody (NBP1-81329).
 

Pathways for RPL4 Antibody (NBP1-81329)

View related products by pathway.

Blogs on RPL4

There are no specific blogs for RPL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
07/20/2018
Application: WB
Species: Human

Bioinformatics

Gene Symbol RPL4