Recombinant Human RPL32 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPL32 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 33-132 of Human RPL32 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPL32

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPL32 Protein

  • M
  • ribosomal protein L32,60S ribosomal protein L32

Background

RPL32 - ribosomal protein L32

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-82855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58847
Species: Hu
Applications: WB, IHC-P
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-57476
Species: Hu
Applications: WB, ICC/IF, IHC
H00006143-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-33622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006161-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RPL32 Partial Recombinant Protein (H00006161-Q01) (0)

There are no publications for RPL32 Partial Recombinant Protein (H00006161-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL32 Partial Recombinant Protein (H00006161-Q01) (0)

There are no reviews for RPL32 Partial Recombinant Protein (H00006161-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL32 Partial Recombinant Protein (H00006161-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL32 Products

Bioinformatics Tool for RPL32 Partial Recombinant Protein (H00006161-Q01)

Discover related pathways, diseases and genes to RPL32 Partial Recombinant Protein (H00006161-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL32 Partial Recombinant Protein (H00006161-Q01)

Discover more about diseases related to RPL32 Partial Recombinant Protein (H00006161-Q01).
 

Pathways for RPL32 Partial Recombinant Protein (H00006161-Q01)

View related products by pathway.

PTMs for RPL32 Partial Recombinant Protein (H00006161-Q01)

Learn more about PTMs related to RPL32 Partial Recombinant Protein (H00006161-Q01).

Blogs on RPL32

There are no specific blogs for RPL32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPL32 Antibody
NBP2-30682

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPL32 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL32